Basic Vector Information
- Vector Name:
- pMV5
- Length:
- 10047 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Inui M, Tsuge Y, Suzuki N, Vertes AA, Yukawa H.
- Promoter:
- sacB
pMV5 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMV5 vector Sequence
LOCUS V004389 10047 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004389 VERSION V004389 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10047) AUTHORS Inui M, Tsuge Y, Suzuki N, Vertes AA, Yukawa H. TITLE Isolation and characterization of a native composite transposon, Tn14751, carrying 17.4 kilobases of Corynebacterium glutamicum chromosomal DNA JOURNAL Appl. Environ. Microbiol. 71 (1), 407-416 (2005) PUBMED 15640215 REFERENCE 2 (bases 1 to 10047) AUTHORS Inui M. TITLE Direct Submission JOURNAL Submitted (01-JUL-2004) Masayuki Inui, Research Institute of Innovative Technology for the Earth (RITE), Microbiology Research Group; 9-2 Kizugawadai, Kizu, Soraku, Kyoto 619-0292, Japan (E-mail:inui@rite.or.jp, Tel:81-774-75-2308, Fax:81-774-75-2321) REFERENCE 3 (bases 1 to 10047) TITLE Direct Submission REFERENCE 4 (bases 1 to 10047) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2005"; volume: "71"; issue: "1"; pages: "407-416" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-JUL-2004) Masayuki Inui, Research Institute of Innovative Technology for the Earth (RITE), Microbiology Research Group"; volume: " 9-2 Kizugawadai, Kizu, Soraku, Kyoto 619-0292, Japan (E-mail:inui@rite.or.jp, Tel:81-774-75-2308, Fax"; pages: "81-774-75-2321" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10047 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 870..2357 /codon_start=1 /gene="repA" /product="RepA" /label="repA" /protein_id="BAD83816.1" /translation="MYMIIPNSTPAYPISGSRVNTPSRLRPDCAGLDDTPASTVDRDKL LAHLGRTALHGSISRNFKGAYRLVVDKETGEKRSVPNLYRIDSEKLGRCEYVMLTSKQY ASVMVIDVDQIGEAGGHPENLNSYVKGVIWVLVQHGIGPAWAGINPISGKAQFIWLIDP VYAGKNRASRNMELLKATSHELGELLDHDPHFAHRFSRSPFYTGKSPEAYRWYCQHDRV IRLQDFLRQVREMAGQSQHIKNKRQQFNSGRELINAVKTRREEAQAFKALAEDVENEIS EEIDQYDPELIDGVRVRWISQGVAARDETAFSHALKIGHRLRKAGQRLTDAAVIDAYEH AYNVAQQQGSAGRDSEMPPMRDRQTMARRVRGYVTQSKTNTSLGASAPGRVTSSERKAL ATMGRKGGQKAAQRWKTDPEGQYAQNQLQKLKKTHRKKRVEGQTTRAKIQALIGEAYVQ TGEVLTRKQIVDETGLSRATVTRHLAALREQGALPET" gene 870..2357 /gene="repA" /label="repA" regulatory 2067..2076 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" primer_bind complement(4213..4229) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 4237..4253 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4261..4291) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(4306..4327) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4615..5203) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 5692..5708 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 5749..6194 /label="sacB promoter" /note="sacB promoter and control region" CDS 6195..7613 /label="SacB" /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" CDS 7823..8602 /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" mobile_element complement(8764..9531) /label="IS1" /note="prokaryotic transposable element" primer_bind 10005..10021 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants"
This page is informational only.