Basic Vector Information
- Vector Name:
- pMUTcJUN
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5331 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zheng C-F.
- Promoter:
- CMV
pMUTcJUN vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMUTcJUN vector Sequence
LOCUS 40924_32743 5331 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMUTcJUN, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5331) AUTHORS Zheng C-F. TITLE pMUTcJUN JOURNAL Unpublished REFERENCE 2 (bases 1 to 5331) AUTHORS Zheng C-F. TITLE Direct Submission JOURNAL Submitted (06-MAY-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Rd., La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 5331) TITLE Direct Submission REFERENCE 4 (bases 1 to 5331) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAY-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Rd., La Jolla, CA 92037, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5331 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 67..370 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 371..574 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 642..1082 /codon_start=1 /label=GAL4 DNA binding domain /note="DNA binding domain of the GAL4 transcriptional activator" /translation="MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTK RSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNK DAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVS" CDS complement(1122..1133) /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" polyA_signal 2125..2246 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2253..2708) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2735..2839 /label=AmpR promoter promoter 2841..3198 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3233..4024 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 4259..4306 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4635..5223 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.