Basic Vector Information
- Vector Name:
- pMU1810
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 10413 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Mearls EB, Olson DG, Herring CD, Lynd LR.
- Promoter:
- URA3
pMU1810 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMU1810 vector Sequence
LOCUS V004408 10413 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004408
VERSION V004408
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 10413)
AUTHORS Mearls EB, Olson DG, Herring CD, Lynd LR.
TITLE Development of a regulatable plasmid-based gene expression system
for Clostridium thermocellum
JOURNAL Appl. Microbiol. Biotechnol. 99 (18), 7589-7599 (2015)
PUBMED 25994254
REFERENCE 2 (bases 1 to 10413)
AUTHORS Argyros A, Mearls EB.
TITLE Direct Submission
JOURNAL Submitted (13-MAR-2013) Engineering, Dartmouth College, 14
Engineering Dr, Hanover, NH 03755, USA
REFERENCE 3 (bases 1 to 10413)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10413)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Microbiol. Biotechnol."; date: "2015"; volume: "99"; issue: "18";
pages: "7589-7599"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr,
Hanover, NH 03755, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10413
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(294..1094)
/label="URA3"
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
promoter complement(1095..1315)
/label="URA3 promoter"
misc_feature 1343..1846
/label="CEN/ARS"
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
misc_recomb 1888..3099
/label="spo0A 3' flank for homologous recombination"
/note="spo0A 3' flank for homologous recombination"
misc_recomb 3100..4192
/label="spo0A 5' flank for homologous recombination"
/note="spo0A 5' flank for homologous recombination"
CDS complement(4311..4856)
/codon_start=1
/gene="hpt"
/product="Hpt"
/label="hpt"
/note="hypoxanthine phosphoribosyl transferase"
/protein_id="AGT95731.1"
/translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK
GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII
DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD
EKYRNLPFIGVLKPEMYS"
gene complement(4311..4856)
/gene="hpt"
/label="hpt"
CDS complement(4882..5529)
/gene="cat"
/label="Chloramphenicol acetyltransferase"
/note="Chloramphenicol acetyltransferase from
Staphylococcus aureus. Accession#: P00485"
regulatory complement(5530..6057)
/gene="gapD"
/regulatory_class="promoter"
gene complement(5530..6057)
/gene="gapD"
/label="gapD"
misc_feature 6058..6800
/note="fragment of Spo0A; sporulation master regulator-like
protein"
CDS complement(6801..7379)
/codon_start=1
/gene="tdk"
/product="Tdk"
/label="tdk"
/note="thymidine kinase"
/protein_id="AGT95733.1"
/translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
ANYDDPIIMVGAKESYEARCRKCHEVPRT"
gene complement(6801..7379)
/gene="tdk"
/label="tdk"
regulatory complement(7380..8000)
/gene="cbp"
/regulatory_class="promoter"
gene complement(7380..8000)
/gene="cbp"
/label="cbp"
CDS complement(8110..9111)
/label="repB"
/note="RepB replication protein"
rep_origin complement(9803..10391)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.