Basic Vector Information
- Vector Name:
- pMU103
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11499 bp
- Type:
- UNVERIFIED: Binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Zhang ZJ.
- Promoter:
- CaMV 35S
pMU103 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMU103 vector Sequence
LOCUS 40924_32683 11499 bp DNA circular SYN 18-DEC-2018 DEFINITION UNVERIFIED: Binary vector pMU103, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11499) AUTHORS Zhang ZJ. TITLE Direct Submission JOURNAL Submitted (15-FEB-2016) Division of Plant Sciences, University of Missouri, 1-33 Agriculture Building, Columbia, MO 65211, USA REFERENCE 2 (bases 1 to 11499) TITLE Direct Submission REFERENCE 3 (bases 1 to 11499) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (15-FEB-2016) Division of Plant Sciences, University of Missouri, 1-33 Agriculture Building, Columbia, MO 65211, USA" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Edena v. 2008/2013 Coverage :: 10X Sequencing Technology :: Illumina ##Assembly-Data-END## GenBank staff is unable to verify sequence and/or annotation provided by the submitter. FEATURES Location/Qualifiers source 1..11499 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1187..1813 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 2250..3314 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" rep_origin 3383..3577 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 3921..4061 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4247..4835) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5082..5870) /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" misc_feature 6398..6422 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" primer_bind 6637..6653 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(7223..7771) /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" promoter complement(7923..8267) /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" terminator complement(8384..9091) /label=OCS terminator /note="octopine synthase terminator" primer_bind complement(11150..11166) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 11362..11386 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.