Basic Vector Information
- Vector Name:
- pMTL-JH17
- Length:
- 4704 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP.
pMTL-JH17 vector Map
pMTL-JH17 vector Sequence
LOCUS V004440 4704 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004440
VERSION V004440
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 4704)
AUTHORS Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton
NP.
TITLE Integration of DNA into bacterial chromosomes from plasmids without
a counter-selection marker
JOURNAL Nucleic Acids Res. 40 (8), E59 (2012)
PUBMED 22259038
REFERENCE 2 (bases 1 to 4704)
AUTHORS Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP.
TITLE Direct Submission
JOURNAL Submitted (11-JAN-2011) School of Molecular Medical Sciences, The
University of Nottingham, Centre for Biomolecular Sciences,
University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom
REFERENCE 3 (bases 1 to 4704)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4704)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-JAN-2011) School of Molecular Medical Sciences, The University
of Nottingham, Centre for Biomolecular Sciences, University Park,
Nottingham, Nottinghamshire NG7 2RD, United Kingdom"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4704
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 9..308
/gene="pyrE fragment"
/note="mediates homologous recombination with the
chromosome of Clostridium difficile 630"
gene 9..308
/gene="pyrE fragment"
/label="pyrE fragment"
primer_bind complement(427..443)
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
regulatory 591..632
/label="derived from fdx gene of Clostridium pasteurianum"
/note="derived from fdx gene of Clostridium pasteurianum"
/regulatory_class="terminator"
CDS 1359..1676
/codon_start=1
/gene="repH"
/product="plasmid replication protein"
/label="repH"
/protein_id="AFA34957.1"
/translation="MKRRAYMKTCKNCKEFIKDTEICKIHSLMIHDKTVATYCSKYNES
RCLHKGKVQCINCSKMNRYGWCAIKMRCFTEEEQKKERTCIKYYARSFKKAHVKKSKKK
K"
gene 1359..1676
/gene="repH"
/label="repH"
CDS 2348..2968
/gene="catP"
/label="Chloramphenicol acetyltransferase"
/note="Chloramphenicol acetyltransferase from Clostridium
perfringens. Accession#: P26826"
rep_origin 3148..3736
/direction=RIGHT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
oriT 4057..4166
/label="oriT"
/note="incP origin of transfer"
CDS 4199..4567
/label="traJ"
/note="oriT-recognizing protein"
This page is informational only.