pMTL-JH1 vector (Cat. No.: V004447)
Basic Information
- Name:
- pMTL-JH1
- Length:
- 3195 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP.
pMTL-JH1 vector (Cat. No.: V004447) Sequence
LOCUS V004447 3195 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004447
VERSION V004447
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 3195)
AUTHORS Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton
NP.
TITLE Integration of DNA into bacterial chromosomes from plasmids without
a counter-selection marker
JOURNAL Nucleic Acids Res. 40 (8), E59 (2012)
PUBMED 22259038
REFERENCE 2 (bases 1 to 3195)
AUTHORS Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP.
TITLE Direct Submission
JOURNAL Submitted (11-JAN-2011) School of Molecular Medical Sciences, The
University of Nottingham, Centre for Biomolecular Sciences,
University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom
REFERENCE 3 (bases 1 to 3195)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3195)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-JAN-2011) School of Molecular Medical Sciences, The University
of Nottingham, Centre for Biomolecular Sciences, University Park,
Nottingham, Nottinghamshire NG7 2RD, United Kingdom"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3195
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 9..306
/gene="pyrF fragment"
/note="mediates homologous recombination with the
chromosome of Clostridium acetobutylicum ATCC824"
gene 9..306
/gene="pyrF fragment"
/label="pyrF fragment"
primer_bind complement(431..447)
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
regulatory 595..636
/label="derived from fdx gene of Clostridium pasteurianum"
/note="derived from fdx gene of Clostridium pasteurianum"
/regulatory_class="terminator"
CDS 1015..1455
/codon_start=1
/gene="repL"
/product="plasmid replication protein"
/label="repL"
/protein_id="AFA34922.1"
/translation="MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQ
LISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGN
IIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEID"
gene 1015..1455
/gene="repL"
/label="repL"
CDS 1605..2225
/gene="catP"
/label="Chloramphenicol acetyltransferase"
/note="Chloramphenicol acetyltransferase from Clostridium
perfringens. Accession#: P26826"
rep_origin 2405..2993
/direction=RIGHT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.