pmT8 vector (V004450)

Basic Vector Information

      • Vector Name:
      • pmT8
      • Antibiotic Resistance:
      • Tetracycline
      • Length:
      • 8721 bp
      • Type:
      • Binary vector
      • Replication origin:
      • oriV
      • Source/Author:
      • Kuroda M, Kimizu M, Mikami C.

pmT8 vector Vector Map

pmT88721 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400T-DNA right borderTetRTcRtrfAtraJoriToriVLB T-DNA repeatMCS

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pmT8 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_32480        8721 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pmT8 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8721)
  AUTHORS   Kuroda M, Kimizu M, Mikami C.
  TITLE     A simple set of plasmids for the production of transgenic plants
  JOURNAL   Biosci. Biotechnol. Biochem. 74 (11), 2348-2351 (2010)
  PUBMED    21071849
REFERENCE   2  (bases 1 to 8721)
  AUTHORS   Kuroda M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAR-2010) Contact:Masaharu Kuroda National 
            Agricultural Research Center, Rice Physiology Research Team; Inada 
            1-2-1, Joetsu, Niigata 943-0193, Japan
REFERENCE   3  (bases 1 to 8721)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8721)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. 
            Biotechnol. Biochem."; date: "2010"; volume: "74"; issue: "11"; 
            pages: "2348-2351"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (19-MAR-2010) Contact:Masaharu Kuroda National Agricultural Research
            Center, Rice Physiology Research Team; Inada 1-2-1, Joetsu, Niigata 
            943-0193, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8721
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    39..63
                     /label=T-DNA right border
                     /note="T-DNA right border"
     CDS             complement(1613..2260)
                     /codon_start=1
                     /label=TetR
                     /note="tetracycline resistance regulatory protein"
                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF
                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR
                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE
                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"
     CDS             2366..3562
                     /codon_start=1
                     /label=TcR
                     /note="tetracycline efflux protein"
                     /translation="VKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY
                     GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI
                     VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF
                     FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM
                     QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM
                     LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL
                     AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR
                     "
     CDS             complement(4841..5986)
                     /codon_start=1
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS
                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK
                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR
                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF
                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT
                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM
                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"
     CDS             complement(6261..6629)
                     /codon_start=1
                     /label=traJ
                     /note="oriT-recognizing protein"
                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
                     KQDELGKVMMGVVRPRAEP"
     oriT            complement(6662..6771)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     rep_origin      6916..7625
                     /label=oriV
                     /note="incP origin of replication"
     misc_feature    7920..7944
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     misc_feature    complement(8656..8712)
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"

This page is informational only.