Basic Vector Information
pmT8 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pmT8 vector Sequence
LOCUS 40924_32480 8721 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pmT8 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8721) AUTHORS Kuroda M, Kimizu M, Mikami C. TITLE A simple set of plasmids for the production of transgenic plants JOURNAL Biosci. Biotechnol. Biochem. 74 (11), 2348-2351 (2010) PUBMED 21071849 REFERENCE 2 (bases 1 to 8721) AUTHORS Kuroda M. TITLE Direct Submission JOURNAL Submitted (19-MAR-2010) Contact:Masaharu Kuroda National Agricultural Research Center, Rice Physiology Research Team; Inada 1-2-1, Joetsu, Niigata 943-0193, Japan REFERENCE 3 (bases 1 to 8721) TITLE Direct Submission REFERENCE 4 (bases 1 to 8721) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. Biotechnol. Biochem."; date: "2010"; volume: "74"; issue: "11"; pages: "2348-2351" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-MAR-2010) Contact:Masaharu Kuroda National Agricultural Research Center, Rice Physiology Research Team; Inada 1-2-1, Joetsu, Niigata 943-0193, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8721 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 39..63 /label=T-DNA right border /note="T-DNA right border" CDS complement(1613..2260) /codon_start=1 /label=TetR /note="tetracycline resistance regulatory protein" /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD" CDS 2366..3562 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="VKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR " CDS complement(4841..5986) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" CDS complement(6261..6629) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(6662..6771) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 6916..7625 /label=oriV /note="incP origin of replication" misc_feature 7920..7944 /label=LB T-DNA repeat /note="left border repeat from octopine Ach5 T-DNA" misc_feature complement(8656..8712) /label=MCS /note="pUC18/19 multiple cloning site"
This page is informational only.