Basic Vector Information
- Vector Name:
- pMSD2
- Length:
- 5833 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Meng J, Wang H, Liu X, Lin J, Pang X, Lin J.
- Promoter:
- tac
pMSD2 vector Map
pMSD2 vector Sequence
LOCUS 40924_32390 5833 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pMSD2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5833)
AUTHORS Meng J, Wang H, Liu X, Lin J, Pang X, Lin J.
TITLE Construction of small plasmid vectors for use in genetic improvement
of the extremely acidophilic Acidithiobacillus caldus
JOURNAL Microbiol. Res. 168 (8), 469-476 (2013)
PUBMED 23639949
REFERENCE 2 (bases 1 to 5833)
AUTHORS Meng J, Wang H, Liu X.
TITLE Direct Submission
JOURNAL Submitted (27-FEB-2013) State Key Laboratory of Microbial
Technology, Shandong University, Shanda Nanlu 27#, Jinan, Shandong
250100, China
REFERENCE 3 (bases 1 to 5833)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5833)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol.
Res."; date: "2013"; volume: "168"; issue: "8"; pages: "469-476"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(27-FEB-2013) State Key Laboratory of Microbial Technology, Shandong
University, Shanda Nanlu 27#, Jinan, Shandong 250100, China"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5833
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 1023..1792
/label=pBBR1 oriV
/note="replication origin of the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica; requires the pBBR1
Rep protein for replication"
CDS 1793..2452
/codon_start=1
/label=pBBR1 Rep
/note="replication protein for the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica"
/translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
primer_bind 3162..3178
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3188..3206
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 3215..3322
/label=MCS
/note="pBluescript multiple cloning site"
protein_bind complement(3339..3355)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3363..3391)
/label=tac promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
CDS 3656..4459
/codon_start=1
/gene="strA"
/product="Sm resistance protein A"
/label=strA
/protein_id="AGT62536.1"
/translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRR
GELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPS
MGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPLHDLLARV
ERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIA
NAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
gene 3656..4459
/gene="strA"
/label=strA
CDS 4459..5295
/codon_start=1
/gene="strB"
/product="Sm resistance protein B"
/label=strB
/protein_id="AGT62537.1"
/translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKP
IEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIA
AELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNA
SELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIA
QMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY"
gene 4459..5295
/gene="strB"
/label=strB
This page is informational only.