Basic Vector Information
- Vector Name:
- pMRE106_PnptII_eBFP2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 13617 bp
- Type:
- Tn7 delivery vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Remus-Emsermann MNP., Gisler P, Drissner D.
- Promoter:
- araBAD
pMRE106_PnptII_eBFP2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMRE106_PnptII_eBFP2 vector Sequence
LOCUS 40924_32235 13617 bp DNA circular SYN 18-DEC-2018 DEFINITION Tn7 delivery vector pMRE106_PnptII_eBFP2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 13617) AUTHORS Remus-Emsermann MNP., Gisler P, Drissner D. TITLE MiniTn7-transposon delivery vectors for inducible or constitutive fluorescent protein expression in Enterobacteriaceae JOURNAL Unpublished REFERENCE 2 (bases 1 to 13617) AUTHORS Remus-Emsermann MNP., Drissner D. TITLE Direct Submission JOURNAL Submitted (23-MAR-2016) Institute for Food Sciences, Agroscope, Schloss 1, Waedenswil, Zurich 8820, Switzerland REFERENCE 3 (bases 1 to 13617) TITLE Direct Submission REFERENCE 4 (bases 1 to 13617) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-MAR-2016) Institute for Food Sciences, Agroscope, Schloss 1, Waedenswil, Zurich 8820, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13617 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(149..1024) /label=araC /note="L-arabinose regulatory protein" promoter 1051..1335 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 1453..2271 /gene="tnsA" /label=tnsA /note="Transposon Tn7 transposition protein TnsA from Escherichia coli. Accession#: P13988" CDS 2261..4366 /gene="tnsB" /label=tnsB /note="Transposon Tn7 transposition protein TnsB from Escherichia coli. Accession#: P13989" CDS 4366..6030 /gene="tnsC" /label=tnsC /note="Transposon Tn7 transposition protein TnsC from Escherichia coli. Accession#: P05846" CDS 6036..7562 /codon_start=1 /gene="tnsD" /product="TnsD" /label=tnsD /note="Tn7 transposition site-selector" /protein_id="AMZ00016.1" /translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE" gene 6036..7562 /gene="tnsD" /label=tnsD terminator 8196..8282 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 8374..8401 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 8420..8511 /label=AmpR promoter CDS 8512..9369 /label=AmpR /note="beta-lactamase" oriT complement(9543..9652) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 10392..10614 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 10662..11609 /label=Rep101(Ts) /note="temperature-sensitive version of the RepA protein needed for replication with the pSC101 origin (Armstrong et al., 1984)" mobile_element 12045..12210 /label=Tn7L /note="mini-Tn7 element (left end of the Tn7 transposon)" regulatory 12294..12612 /label=nptII promoter /note="nptII promoter" /regulatory_class="promoter" CDS 12642..13358 /label=EBFP2 /note="enhanced blue variant of GFP (Ai et al., 2007)" repeat_region 13406..13617 /label=Tn7 right end /note="Tn7 right end"
This page is informational only.