pMRE101_Ptac_eCFP vector (V004480)

Download GeneBank File(.gb)

LOCUS       40924_32210       13352 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Tn7 delivery vector pMRE101_Ptac_eCFP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13352)
  AUTHORS   Remus-Emsermann MNP., Gisler P, Drissner D.
  TITLE     MiniTn7-transposon delivery vectors for inducible or constitutive 
            fluorescent protein expression in Enterobacteriaceae
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 13352)
  AUTHORS   Remus-Emsermann MNP., Drissner D.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-2016) Institute for Food Sciences, Agroscope, 
            Schloss 1, Waedenswil, Zurich 8820, Switzerland
REFERENCE   3  (bases 1 to 13352)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13352)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-MAR-2016) Institute for Food Sciences, Agroscope, Schloss 1, 
            Waedenswil, Zurich 8820, Switzerland"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13352
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(149..1024)
                     /label=araC
                     /note="L-arabinose regulatory protein"
     promoter        1051..1335
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     CDS             1453..2271
                     /gene="tnsA"
                     /label=tnsA
                     /note="Transposon Tn7 transposition protein TnsA from 
                     Escherichia coli. Accession#: P13988"
     CDS             2261..4366
                     /gene="tnsB"
                     /label=tnsB
                     /note="Transposon Tn7 transposition protein TnsB from 
                     Escherichia coli. Accession#: P13989"
     CDS             4366..6030
                     /gene="tnsC"
                     /label=tnsC
                     /note="Transposon Tn7 transposition protein TnsC from 
                     Escherichia coli. Accession#: P05846"
     CDS             6036..7562
                     /codon_start=1
                     /gene="tnsD"
                     /product="TnsD"
                     /label=tnsD
                     /note="Tn7 transposition site-selector"
                     /protein_id="AMY99980.1"
                     /translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT
                     LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV
                     HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR
                     AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY
                     QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA
                     FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ
                     LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA
                     VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY
                     QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE"
     gene            6036..7562
                     /gene="tnsD"
                     /label=tnsD
     terminator      8196..8282
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      8374..8401
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        8420..8511
                     /label=AmpR promoter
     CDS             8512..9369
                     /label=AmpR
                     /note="beta-lactamase"
     oriT            complement(9543..9652)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     rep_origin      10392..10614
                     /label=pSC101 ori
                     /note="low-copy replication origin that requires the Rep101
                     protein"
     CDS             10662..11609
                     /label=Rep101(Ts)
                     /note="temperature-sensitive version of the RepA protein
                     needed for replication with the pSC101 origin (Armstrong et
                     al., 1984)"
     mobile_element  12045..12210
                     /label=Tn7L
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"
     promoter        12302..12330
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    12338..12354
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             12377..13093
                     /label=ECFP
                     /note="enhanced CFP"
     repeat_region   13141..13352
                     /label=Tn7 right end
                     /note="Tn7 right end"