Basic Vector Information
- Vector Name:
- pMR361-K
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7836 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Narayanan AM, Ramsey MM, Stacy A, Whiteley M.
pMR361-K vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMR361-K vector Sequence
LOCUS 40924_32195 7836 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMR361-K, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7836) AUTHORS Narayanan AM, Ramsey MM, Stacy A, Whiteley M. TITLE Genomic resources for an oral pathogen JOURNAL Unpublished REFERENCE 2 (bases 1 to 7836) AUTHORS Ramsey MM. TITLE Direct Submission JOURNAL Submitted (13-MAR-2017) Department of Molecular Biosciences, The University of Texas at Austin, 2506 Speedway, NMS 3.254, Austin, TX 78712, USA REFERENCE 3 (bases 1 to 7836) TITLE Direct Submission REFERENCE 4 (bases 1 to 7836) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAR-2017) Department of Molecular Biosciences, The University of Texas at Austin, 2506 Speedway, NMS 3.254, Austin, TX 78712, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7836 /mol_type="other DNA" /organism="synthetic DNA construct" oriT 35..144 /label=oriT /note="incP origin of transfer" CDS 177..545 /label=traJ /note="oriT-recognizing protein" CDS 604..1344 /codon_start=1 /product="TraI" /label=TraI /protein_id="ARI46004.1" /translation="MRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANTLPAVMAE VMATQHGNTRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQRVSAVHHD TDNLHIHIAINKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQRVSENRA NDMERHAGVESLVGWILYAGRIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFG VGMVAGPVAGGLLGAISLLPRAFR" promoter complement(1616..1720) /label=AmpR promoter rep_origin 1918..2506 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2794..2815 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2830..2860 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2868..2884 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2892..2908 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2962..4008 /codon_start=1 /product="transposase" /label=transposase /protein_id="ARI46007.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI ALEGNYVE" mobile_element 4020..4098 /mobile_element_type="transposon:mariner" /label=ner /note="repeat end" promoter complement(4104..4122) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 4123..4139 /note="M13 rev; common sequencing primer, one of multiple similar variants" CDS complement(4208..4999) /label=KanR /note="aminoglycoside phosphotransferase" promoter 5517..5535 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" mobile_element 5541..5640 /mobile_element_type="transposon:mariner" /label=ner /note="repeat end" CDS 6012..6686 /codon_start=1 /product="spectinomycin resistance cassette" /label=spectinomycin resistance cassette /note="SpcR" /protein_id="ARI46006.1" /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK KL" rep_origin complement(6871..7227) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.