Basic Vector Information
- Vector Name:
- pMQ89
- Antibiotic Resistance:
- Gentamicin
- Length:
- 4105 bp
- Type:
- Shuttle/suicide vector
- Replication origin:
- ori
- Source/Author:
- Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'toole GA.
- Promoter:
- Pc
pMQ89 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMQ89 vector Sequence
LOCUS 40924_32175 4105 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle/suicide vector pMQ89, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4105)
AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'toole GA.
TITLE Saccharomyces cerevisiae-Based Molecular Tool Kit for Manipulation
of Genes from Gram-Negative Bacteria
JOURNAL Appl. Environ. Microbiol. 72 (7), 5027-5036 (2006)
PUBMED 16820502
REFERENCE 2 (bases 1 to 4105)
AUTHORS Shanks RMQ., Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA.
TITLE Direct Submission
JOURNAL Submitted (16-SEP-2005) Microbiology and Immunology, Dartmouth
Medical School, Vail Building Room 505, Hanover, NH 03755, USA
REFERENCE 3 (bases 1 to 4105)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4105)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2006"; volume: "72"; issue: "7"; pages:
"5027-5036"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(16-SEP-2005) Microbiology and Immunology, Dartmouth Medical School,
Vail Building Room 505, Hanover, NH 03755, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4105
/mol_type="other DNA"
/organism="synthetic DNA construct"
oriT complement(352..461)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
terminator complement(882..909)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(1001..1087)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 1437..1453
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature complement(1457..1513)
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(1523..1539)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1547..1563)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1571..1601)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1616..1637)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1925..2513)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2769..3299)
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
promoter complement(3488..3516)
/label=Pc promoter
/note="class 1 integron promoter"
promoter complement(3534..3638)
/label=AmpR promoter
This page is informational only.