Basic Vector Information
- Vector Name:
- pMQ61
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7978 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'toole GA.
- Promoter:
- TEF
pMQ61 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMQ61 vector Sequence
LOCUS 40924_32120 7978 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMQ61, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7978) AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'toole GA. TITLE Saccharomyces cerevisiae-Based Molecular Tool Kit for Manipulation of Genes from Gram-Negative Bacteria JOURNAL Appl. Environ. Microbiol. 72 (7), 5027-5036 (2006) PUBMED 16820502 REFERENCE 2 (bases 1 to 7978) AUTHORS Shanks RMQ., Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (16-SEP-2005) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 7978) TITLE Direct Submission REFERENCE 4 (bases 1 to 7978) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2006"; volume: "72"; issue: "7"; pages: "5027-5036" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-SEP-2005) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7978 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..801 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" misc_feature 964..997 /label=loxP /note="loxP" protein_bind 964..997 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." gene complement(1060..2416) /label=kanMX /note="yeast selectable marker conferring kanamycin resistance (Wach et al., 1994)" protein_bind complement(2471..2504) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." rep_origin complement(2555..2906) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 2920..3750 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" primer_bind 3914..3930 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3940..3958 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(3967..4074) /label=MCS /note="pBluescript multiple cloning site" promoter complement(4087..4105) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4126..4142) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4150..4166) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4174..4204) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4219..4240) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4528..5116) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5328..5858) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(6047..6075) /label=Pc promoter /note="class 1 integron promoter" rep_origin complement(6152..7494) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 7758..7978 /label=URA3 promoter
This page is informational only.