pMQ2 vector (V004515)

LOCUS       V004515                 8636 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004515
VERSION     V004515
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8636)
  AUTHORS   Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
  TITLE     New yeast recombineering tools for bacteria
  JOURNAL   Plasmid 62 (2), 88-97 (2009)
   PUBMED   19477196
REFERENCE   2  (bases 1 to 8636)
  AUTHORS   Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA.
  TITLE     In vivo recombination vectors for modification and expression of
            genes in Gram-negative and Gram-positive bacteria
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 8636)
  AUTHORS   Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2008) Ophthalmology, University of Pittsburgh, 203
            Lothrop St., Pittsburgh, PA 15213, USA
REFERENCE   4  (bases 1 to 8636)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 8636)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid";
            date: "2009"; volume: "62"; issue: "2"; pages: "88-97"
            SGRef: number: 2; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (03-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop
            St., Pittsburgh, PA 15213, USA"
            SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8636
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        196..416
                     /label="URA3 promoter"
     CDS             417..1217
                     /label="URA3"
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     rep_origin      complement(1351..1806)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     1951..1967
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        1977..1995
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     2021..2037
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      2274..2431
                     /label="palA lagging strand origin"
                     /note="palA lagging strand origin"
     CDS             complement(2573..3220)
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     CDS             complement(3389..3772)
                     /codon_start=1
                     /gene="rep"
                     /product="replication protein"
                     /label="rep"
                     /protein_id="ACB45180.1"
                     /translation="MHLILSNMTFNKFLKYLISLFFLSILFHVITHKNNLVFTNYDNKK
                     SCFFPFLCMFFTSHLKRYINRYEKATFFALKTSHTNNLRVTSLAGNSYPYYQDKKEKDF
                     SLRSNPLKKHKRPHFLMWSLFFN"
     gene            complement(3389..3772)
                     /gene="rep"
                     /label="rep"
     rep_origin      3427..3555
                     /label="oriV for pC194"
                     /note="oriV for pC194"
     CDS             3677..4366
                     /codon_start=1
                     /gene="pre"
                     /product="Pre"
                     /label="pre"
                     /note="pC194 OrfA"
                     /protein_id="ACB45181.1"
                     /translation="MCYNMEKYTEKKQRNQVFQKFIKRHIGENQMDLVEDCNTFLSFVA
                     DKTLEKQKLYKANSCKNRFCPVCAWRKARKDALGLSLMMQYIKQQEKKEFIFLTLTTPN
                     VMSDELENEIKRYNNSFRKLIKRKKVGSVIKGYVRKLEITYNKKRDDYNPHFHVLIAVN
                     KSYFTDKRYYISQQEWLDLWRDVTGISEITQVQVQKIRQNNNKELYEMAKYSGKDSDYL
                     INKSKSL"
     gene            3677..4366
                     /gene="pre"
                     /label="pre"
     misc_feature    4613..4699
                     /label="palB"
                     /note="palB"
     CDS             4713..4727
                     /label="enterokinase site"
                     /note="enterokinase recognition and cleavage site"
     primer_bind     complement(4981..4997)
                     /label="SK primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        complement(5034..5052)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(5073..5089)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(5097..5113)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5121..5151)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5166..5187)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5475..6063)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(6237..7094)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(7095..7199)
                     /label="AmpR promoter"
     rep_origin      complement(7226..8568)
                     /direction=LEFT
                     /label="2u ori"
                     /note="yeast 2u plasmid origin of replication"