Basic Vector Information
- Vector Name:
- pMQ175
- Antibiotic Resistance:
- Gentamicin
- Length:
- 6996 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
- Promoter:
- araBAD
pMQ175 vector Map
pMQ175 vector Sequence
LOCUS 40924_32025 6996 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pMQ175, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6996)
AUTHORS Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
TITLE New yeast recombineering tools for bacteria
JOURNAL Plasmid 62 (2), 88-97 (2009)
PUBMED 19477196
REFERENCE 2 (bases 1 to 6996)
AUTHORS Shanks RMQ., Kadouri DE, O'Toole GA.
TITLE Recombineering vectors for a wide range of Gram-negative and
-positive bacteria
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 6996)
AUTHORS Shanks RMQ., Kadouri DE, O'Toole GA.
TITLE Direct Submission
JOURNAL Submitted (13-OCT-2008) Ophthalmololgy, University of Pittsburgh,
203 Lothrop St, Pittsburgh, PA 15213, USA
REFERENCE 4 (bases 1 to 6996)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 6996)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid";
date: "2009"; volume: "62"; issue: "2"; pages: "88-97"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(13-OCT-2008) Ophthalmololgy, University of Pittsburgh, 203 Lothrop
St, Pittsburgh, PA 15213, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6996
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 1..801
/codon_start=1
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
oriT complement(893..1001)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
promoter complement(1192..1210)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
rep_origin 1419..1807
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
terminator complement(1890..1976)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 2312..2328
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 2338..2356
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature complement(2365..2472)
/label=MCS
/note="pBluescript multiple cloning site"
promoter complement(2485..2503)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
promoter complement(2546..2830)
/label=araBAD promoter
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction (Guzman et al., 1995)"
CDS 2857..3732
/codon_start=1
/label=araC
/note="L-arabinose regulatory protein"
/translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
EKVNDVAVKLS"
rep_origin 4091..4635
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(5098..5628)
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
promoter complement(5817..5845)
/label=Pc promoter
/note="class 1 integron promoter"
promoter complement(5863..5971)
/label=AmpR promoter
misc_feature 6008..6511
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
promoter 6776..6996
/label=URA3 promoter
This page is informational only.