Basic Vector Information
- Vector Name:
- pMQ131
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6493 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Host:
- Yeast
- Source/Author:
- Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
- Promoter:
- URA3
pMQ131 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMQ131 vector Sequence
LOCUS 40924_32005 6493 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMQ131, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6493) AUTHORS Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA. TITLE New yeast recombineering tools for bacteria JOURNAL Plasmid 62 (2), 88-97 (2009) PUBMED 19477196 REFERENCE 2 (bases 1 to 6493) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE In vivo recombination vectors for modification and expression of genes in Gram-negative and Gram-positive bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 6493) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (04-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA REFERENCE 4 (bases 1 to 6493) TITLE Direct Submission REFERENCE 5 (bases 1 to 6493) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "62"; issue: "2"; pages: "88-97" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (04-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..6493 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(399..508) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(929..956) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(1048..1134) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 1484..1500 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(1504..1560) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(1570..1586) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1594..1610) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1618..1648) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1663..1684) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 1834..2603 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 2604..3263 /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" CDS complement(3567..4358) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" CDS complement(4941..5741) /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" promoter complement(5742..5962) /label=URA3 promoter misc_feature 5990..6493 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.