Basic Vector Information
- Vector Name:
- pMQ123
- Antibiotic Resistance:
- Gentamicin
- Length:
- 9582 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Host:
- Yeast
- Source/Author:
- Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA.
- Promoter:
- URA3
pMQ123 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMQ123 vector Sequence
LOCUS 40924_31985 9582 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMQ123, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9582) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE In vivo recombination vectors for modification and expression of genes in Gram-negative and Gram-positive bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 9582) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (04-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA REFERENCE 3 (bases 1 to 9582) TITLE Direct Submission REFERENCE 4 (bases 1 to 9582) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9582 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..801 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" oriT complement(893..1001) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 1198..1728 /label=oriV /note="incP origin of replication" CDS 2120..3265 /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" terminator complement(3525..3611) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS complement(3841..4554) /codon_start=1 /label=yeGFP /note="yeast-enhanced green fluorescent protein" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" protein_bind complement(4653..4669) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4677..4705) /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" promoter 4935..5012 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 5136..5951 /codon_start=1 /gene="lacI" /product="truncated LacI" /label=lacI /protein_id="ACB45224.1" /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTTWTACCNSLRARR" gene 5136..5951 /gene="lacI" /label=lacI rep_origin complement(6132..6720) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6932..7462) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(7651..7679) /label=Pc promoter /note="class 1 integron promoter" rep_origin complement(7756..9098) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 9362..9582 /label=URA3 promoter
This page is informational only.