Basic Vector Information
- Vector Name:
- pMpGWB434
- Antibiotic Resistance:
- Streptomycin
- Length:
- 13075 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Ishizaki K, Nishihama R, Ueda M, Inoue K, Ishida S, Nishimura Y, Shikanai T, Kohchi T.
- Promoter:
- CaMV35S(enhanced)
pMpGWB434 vector Map
pMpGWB434 vector Sequence
LOCUS 40924_31950 13075 bp DNA circular SYN 18-DEC-2018
DEFINITION Binary vector pMpGWB434 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 13075)
AUTHORS Ishizaki K, Nishihama R, Ueda M, Inoue K, Ishida S, Nishimura Y,
Shikanai T, Kohchi T.
TITLE Development of Gateway Binary Vector Series with Four Different
Selection Markers for the Liverwort Marchantia polymorpha
JOURNAL PLoS ONE 10 (9), E0138876 (2015)
PUBMED 26406247
REFERENCE 2 (bases 1 to 13075)
AUTHORS Nishihama R, Ishizaki K, Kohchi T.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Contact:Ryuichi Nishihama Kyoto University,
Graduate School of Biostudies; Kitashirakawa-oiwake-cho, Sakyo-ku,
Kyoto, Kyoto 606-8502, Japan URL :http://www.lif.kyoto-u.ac.jp/e/
REFERENCE 3 (bases 1 to 13075)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 13075)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2015"; volume: "10"; issue: "9"; pages: "E0138876"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-JUN-2015) Contact:Ryuichi Nishihama Kyoto University, Graduate
School of Biostudies"; volume: " Kitashirakawa-oiwake-cho, Sakyo-ku,
Kyoto, Kyoto 606-8502, Japan URL :http"; pages:
"//www.lif.kyoto-u.ac.jp/e"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..13075
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(54..78)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
primer_bind 281..297
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
regulatory 316..1519
/label=MpHSP17.8A1 promoter
/note="MpHSP17.8A1 promoter"
/regulatory_class="promoter"
protein_bind 1532..1656
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 1693..1723
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
CDS 1777..2433
/label=CmR
/note="chloramphenicol acetyltransferase"
CDS 2778..3080
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(3124..3248)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
CDS 3259..4134
/codon_start=1
/product="ligand binding domain of the glucocorticoid
receptor"
/label=ligand binding domain of the glucocorticoid rec
/note="region_name: GR; glucocorticoid receptor, a member
of the nuclear receptor superfamily"
/protein_id="BAS50134.1"
/translation="MASEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAALPQLTPT
LVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLD
DQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQCKHMLFV
SSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNS
SQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNG
NIKKLLFHQK"
terminator 4150..4402
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
primer_bind complement(4436..4452)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 4460..4476
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4484..4514)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4529..4550)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
polyA_signal complement(4635..4809)
/label=CaMV poly(A) signal
/note="cauliflower mosaic virus polyadenylation signal"
CDS complement(4869..5657)
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
promoter complement(5726..6402)
/label=CaMV 35S promoter (enhanced)
/note="cauliflower mosaic virus 35S promoter with a
duplicated enhancer region"
misc_feature complement(6597..6621)
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
CDS 7142..7930
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin 8179..8767
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(8953..9093)
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(9437..9631)
/direction=LEFT
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(9700..10770)
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(11202..11828)
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
This page is informational only.