pRS416 pRS-TG-She2 vector (V003590)

LOCUS       V003590                 7939 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V003590
VERSION     V003590
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7939)
  AUTHORS   Belmont BJ, Niles JC.
  TITLE     Inducible Control of Subcellular RNA Localization Using a Synthetic
            Protein-RNA Aptamer Interaction
  JOURNAL   PLoS ONE 7 (10), E46868 (2012)
   PUBMED   23056498
REFERENCE   2  (bases 1 to 7939)
  AUTHORS   Belmont BJ, Niles JC.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-2012) Biological Engineering, Massachusetts
            Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139,
            USA
REFERENCE   3  (bases 1 to 7939)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7939)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2012"; volume: "7"; issue: "10"; pages: "E46868"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (12-SEP-2012) Biological Engineering, Massachusetts Institute of
            Technology, 77 Massachusetts Ave, Cambridge, MA 02139, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7939
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        196..416
                     /label="URA3 promoter"
     CDS             417..1217
                     /label="URA3"
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     rep_origin      complement(1351..1806)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     1951..1967
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        1977..1995
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    2269..2386
                     /label="UAS"
                     /note="upstream activating sequence mediating
                     Gal4-dependent induction"
     CDS             2735..3352
                     /codon_start=1
                     /gene="tetR from transposon Tn10"
                     /product="tetracycline repressor TetR"
                     /label="TetR"
                     /note="TetR binds to the tetracycline operator tetO to
                     inhibit transcription. This inhibition can be relieved by
                     adding tetracycline or doxycycline."
                     /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV
                     KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR
                     PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT
                     DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESG"
     CDS             complement(3357..3383)
                     /label="9xHis"
                     /note="9xHis affinity tag"
     CDS             3383..4096
                     /label="EGFP"
                     /note="enhanced GFP"
     CDS             4124..4861
                     /gene="SHE2"
                     /label="SWI5-dependent HO expression protein 2"
                     /note="SWI5-dependent HO expression protein 2 from
                     Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
                     Accession#: P36068"
     promoter        complement(5165..5183)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(5204..5220)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(5228..5244)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5252..5282)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5297..5318)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5606..6194)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(6368..7225)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(7226..7330)
                     /label="AmpR promoter"
     misc_feature    7367..7870
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"