pRP1028 vector (V003641)

LOCUS       V003641                 6537 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V003641
VERSION     V003641
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6537)
  AUTHORS   Plaut RD, Stibitz S.
  TITLE     Improvements to a Markerless Allelic Exchange System for Bacillus
            anthracis
  JOURNAL   PLoS ONE 10 (12), E0142758 (2015)
   PUBMED   26624016
REFERENCE   2  (bases 1 to 6537)
  AUTHORS   Plaut RD, Stibitz S.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-SEP-2015) Center for Biologics Evaluation and
            Research, OVRR, DBPAP, Food and Drug Administration, 10903 New
            Hampshire Ave, Bldg 52/72, Rm 3310, Silver Spring, MD 20993, USA
REFERENCE   3  (bases 1 to 6537)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6537)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2015"; volume: "10"; issue: "12"; pages: "E0142758"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (24-SEP-2015) Center for Biologics Evaluation and Research, OVRR,
            DBPAP, Food and Drug Administration, 10903 New Hampshire Ave, Bldg
            52/72, Rm 3310, Silver Spring, MD 20993, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6537
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    57..74
                     /label="I-SceI site"
                     /note="I-SceI site"
     oriT            225..333
                     /label="oriT"
                     /note="incP origin of transfer"
     promoter        complement(348..366)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(376..392)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      954..2276
                     /label="ts rep from pJRS233, pWV01"
                     /note="ts rep from pJRS233, pWV01"
     CDS             complement(954..1103)
                     /codon_start=1
                     /gene="orfD"
                     /product="OrfD"
                     /label="orfD"
                     /protein_id="ALQ43911.1"
                     /translation="MTNKEKELFAENEELKKEIKDLKERIERYREMEVELSTTIDLLRG
                     GIIE"
     gene            complement(954..1103)
                     /gene="orfD"
                     /label="orfD"
     gene            complement(1100..1798)
                     /gene="repA"
                     /label="repA"
     misc_feature    1623..1640
                     /note="mutations in RepA leading to temperature
                     sensitivity"
     CDS             complement(1865..2026)
                     /codon_start=1
                     /gene="orfC"
                     /product="orfC"
                     /label="orfC"
                     /protein_id="ALQ43915.1"
                     /translation="MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYA
                     RKESEQKK"
     gene            complement(1865..2026)
                     /gene="orfC"
                     /label="orfC"
     CDS             complement(2067..2276)
                     /codon_start=1
                     /gene="orfB"
                     /product="orfB"
                     /label="orfB"
                     /protein_id="ALQ43916.1"
                     /translation="MGGKEANFASVLRPPIKCRVPIFVPKTLYPNWLKGLRGFSIANES
                     PTFSPTFFINLYLSSFIVVFMITK"
     gene            complement(2067..2276)
                     /gene="orfB"
                     /label="orfB"
     CDS             2410..2421
                     /label="Factor Xa site"
                     /note="Factor Xa recognition and cleavage site"
     promoter        2596..2625
                     /label="trc promoter"
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     regulatory      2596..2601
                     /label="Ptrc"
                     /note="Ptrc"
                     /regulatory_class="minus_35_signal"
     regulatory      2619..2623
                     /label="Ptrc"
                     /note="Ptrc"
                     /regulatory_class="minus_10_signal"
     regulatory      2639..2648
                     /regulatory_class="ribosome_binding_site"
     CDS             2656..3435
                     /gene="ant1"
                     /label="Spectinomycin 9-adenylyltransferase"
                     /note="Spectinomycin 9-adenylyltransferase from
                     Staphylococcus aureus (strain N315). Accession#: P0A0D1"
     regulatory      3464..3469
                     /label="PrrnB"
                     /note="PrrnB"
                     /regulatory_class="minus_35_signal"
     regulatory      3487..3492
                     /label="PrrnB"
                     /note="PrrnB"
                     /regulatory_class="minus_10_signal"
     regulatory      3512..3517
                     /label="PFP2"
                     /note="PFP2"
                     /regulatory_class="minus_35_signal"
     regulatory      3535..3540
                     /label="PFP2"
                     /note="PFP2"
                     /regulatory_class="minus_10_signal"
     regulatory      3553..3562
                     /regulatory_class="ribosome_binding_site"
     CDS             3589..4281
                     /label="TurboRFP"
                     /note="red fluorescent protein from Entacmaea quadricolor"
     CDS             complement(4812..5759)
                     /label="Rep101"
                     /note="RepA protein needed for replication with the pSC101
                     origin"
     regulatory      complement(5790..5795)
                     /regulatory_class="minus_10_signal"
     rep_origin      complement(5807..6029)
                     /direction=LEFT
                     /label="pSC101 ori"
                     /note="low-copy replication origin that requires the Rep101
                     protein"
     misc_feature    complement(6140..6508)
                     /label="par"
                     /note="par"