Basic Vector Information
- Vector Name:
- pRMU824
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4012 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Stanislauskiene R, Gasparaviciute R, Vaitekunas J, Meskiene R, Rutkiene R, Casaite V, Meskys R.
pRMU824 vector Map
pRMU824 vector Sequence
LOCUS 40924_37448 4012 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pRMU824, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4012)
AUTHORS Stanislauskiene R, Gasparaviciute R, Vaitekunas J, Meskiene R,
Rutkiene R, Casaite V, Meskys R.
TITLE Construction of Escherichia coli-Arthrobacter-Rhodococcus shuttle
vectors based on a cryptic plasmid from Arthrobacter rhombi and
investigation of their application for functional screening
JOURNAL FEMS Microbiol. Lett. 327 (1), 78-86 (2012)
PUBMED 22098420
REFERENCE 2 (bases 1 to 4012)
AUTHORS Stanislauskiene R.
TITLE Direct Submission
JOURNAL Submitted (16-NOV-2010) Molecular Microbiology and Biotechnology,
Vilnius University Institute of Biochemistry, Mokslininku 12,
Vilnius LT-08662, Lithuania
REFERENCE 3 (bases 1 to 4012)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4012)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FEMS
Microbiol. Lett."; date: "2012"; volume: "327"; issue: "1"; pages:
"78-86"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(16-NOV-2010) Molecular Microbiology and Biotechnology, Vilnius
University Institute of Biochemistry, Mokslininku 12, Vilnius
LT-08662, Lithuania"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4012
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 274..295
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 310..340
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 348..364
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 372..388
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 407..425
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(509..525)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(687..953)
/codon_start=1
/gene="repB"
/product="DNA-binding protein RepB"
/label=repB
/protein_id="AER68062.1"
/translation="MSALDPRRRKITAREAAEQVGCTPRHIRSVVAEPRHEFLARAAER
QRKAADWKDEGLTYREIAERLDCTPKAAENLVLRGRKARKVTA"
gene complement(687..953)
/gene="repB"
/label=repB
CDS complement(953..1792)
/codon_start=1
/gene="repA"
/product="RepA"
/label=repA
/protein_id="AER68063.1"
/translation="MMTAERWAEHYRQKWPMATDHDKGRFPVRQSRADALKRRYIQANP
AALTTQIVIDLDHEDSLGLALELNGVPTPNYVAQSPSGHAHVAYLLAAPVCRTDNARLE
PMKFAARVERGLVNALRADLGYAGFMTKNPIHDGWDTVWTNDHLWTLGELATQLSGWLP
RSLPRRAADNSGLGRNVALFNDVRLWSYRAIRKHWEAGPDAWEQATYAYALAVNHKFAV
PLDASEVVHLARSVSRWTWRNFTPEGFSKVQTRRSQKAAAVRTAEKIVKAELIRSLV"
gene complement(953..1792)
/gene="repA"
/label=repA
CDS complement(2051..2707)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(2708..2810)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
rep_origin complement(3336..3881)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
This page is informational only.