Basic Vector Information
- Vector Name:
- pRMTn-Gm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7306 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Miyazaki R, van der Meer JR.
- Promoter:
- Pc
pRMTn-Gm vector Map
pRMTn-Gm vector Sequence
LOCUS 40924_37433 7306 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pRMTn-Gm DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7306)
AUTHORS Miyazaki R, van der Meer JR.
TITLE A New Large-DNA-Fragment Delivery System Based on Integrase Activity
from an Integrative and Conjugative Element
JOURNAL Appl. Environ. Microbiol. 79 (14), 4440-4447 (2013)
PUBMED 23686268
REFERENCE 2 (bases 1 to 7306)
AUTHORS Miyazaki R, van der Meer JR.
TITLE Direct Submission
JOURNAL Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne,
Department of Fundamental Microbiology; Batiment Biophore, Quartier
UNIL-Sorge, Lausanne 1015, Switzerland
REFERENCE 3 (bases 1 to 7306)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7306)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2013"; volume: "79"; issue: "14";
pages: "4440-4447"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne,
Department of Fundamental Microbiology; Batiment Biophore, Quartier
UNIL-Sorge, Lausanne 1015, Switzerland"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7306
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..19
/label=Tn5 ME
/note="hyperactive mosaic end for Tn5 transposase
recognition (Reznikoff et al., 2004)"
misc_feature 38..85
/label=FRT
/note="FRT"
protein_bind complement(38..85)
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
oriT 225..333
/label=oriT
/note="incP origin of transfer"
promoter 347..375
/label=Pc promoter
/note="class 1 integron promoter"
CDS 564..1094
/label=GmR
/note="gentamycin acetyltransferase"
protein_bind complement(1172..1219)
/label=FRT
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
CDS complement(1577..3550)
/codon_start=1
/gene="intB13"
/product="P4-type integrase"
/label=intB13
/protein_id="BAN28928.1"
/translation="MTSIGPKSLLRSLEMALSDLIVRQAKTTGKRYTLYDNDCLSLMVS
AAGGKSWMFRYSWLGKQKRMALGGYPALSLREARAERDKAQALIARGIDPQIERDQRRH
AAKLAGEYTFKNVFDAWVEHRRKELKEGRQSTLSQILRIFNKDVLPTLGKMSIYDIRRP
QLLGVLAAIEKRKAFTTAEKVRTWFNQMFRYALVIAEGLEVNPAADLDVVAEPKPPVAH
NPYLHLPELPEFLQKLRRYNPRGWQTQLGVRLLFLTGVRTGELRLAEPEQFDLDRGFWI
IPPEVVKQLQDEMRKAGKRPQDVPPYIVPLSLQAIEIVRYLLGVMRPAQKYLLSHRSEL
KKRISENTLNKAVQLMGYEGRLTGHGIRGTISTALNEIGYPKIWVDAQLSHSDPNKVSS
AYNHAKYVEPRRRMMQDWADRLDLLEQGEVQAASAHLTIRIDGVPAMAEVEEAVDVAPT
VAEPGVSGSPPVAATPIVVTPNSGGITFQRLSQVPPPPAHAPESEVSAIQREREEMLAM
YESPNNLPVALFGKLAGKSKDQINRELKAGKLLSISLGNRGQRVPDWQLVPLKRRLAQA
LMNQCPHVDSWALYRLLTKPHSNLGNRAAIDVVTPTNVGKVLQAVTPYKEFERSSTDET
PQFSEFVRQLQRHVNALEEAPC"
gene complement(1577..3550)
/gene="intB13"
/label=intB13
protein_bind complement(3646..3662)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
misc_feature 3754..3771
/label=attP
/note="attP"
regulatory 3840..3868
/label=Pcirc
/note="Pcirc"
/regulatory_class="promoter"
terminator complement(3930..4016)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator complement(4119..4213)
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
misc_feature 4214..4258
/label=multiple cloning site
/note="multiple cloning site"
misc_feature complement(4296..4314)
/label=Tn5 ME
/note="hyperactive mosaic end for Tn5 transposase
recognition (Reznikoff et al., 2004)"
rep_origin complement(4329..4717)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
terminator complement(4734..4773)
/label=fd terminator
/note="central terminator from bacteriophage fd (Otsuka and
Kunisawa, 1982)"
CDS complement(4780..5637)
/label=AmpR
/note="beta-lactamase"
promoter complement(5638..5729)
/label=AmpR promoter
CDS complement(5786..7213)
/label=Tn5 transposase
/note="transposase from the bacterial Tn5 transposon
(Reznikoff, 1993)"
This page is informational only.