Basic Vector Information
- Vector Name:
- pRMR6K-Tc
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6188 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Miyazaki R, van der Meer JR.
- Promoter:
- tet
pRMR6K-Tc vector Map
pRMR6K-Tc vector Sequence
LOCUS 40924_37428 6188 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pRMR6K-Tc DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6188)
AUTHORS Miyazaki R, van der Meer JR.
TITLE A New Large-DNA-Fragment Delivery System Based on Integrase Activity
from an Integrative and Conjugative Element
JOURNAL Appl. Environ. Microbiol. 79 (14), 4440-4447 (2013)
PUBMED 23686268
REFERENCE 2 (bases 1 to 6188)
AUTHORS Miyazaki R, van der Meer JR.
TITLE Direct Submission
JOURNAL Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne,
Department of Fundamental Microbiology; Batiment Biophore, Quartier
UNIL-Sorge, Lausanne 1015, Switzerland
REFERENCE 3 (bases 1 to 6188)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6188)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2013"; volume: "79"; issue: "14";
pages: "4440-4447"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne,
Department of Fundamental Microbiology; Batiment Biophore, Quartier
UNIL-Sorge, Lausanne 1015, Switzerland"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6188
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(1069..2256)
/label=TcR
/note="tetracycline efflux protein"
promoter complement(2304..2332)
/label=tet promoter
/note="E. coli promoter for tetracycline efflux protein
gene"
oriT complement(2419..2527)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
protein_bind 2667..2714
/label=FRT
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
rep_origin 2721..3109
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
misc_feature 3111..3146
/label=multiple cloning site
/note="multiple cloning site"
terminator 3147..3241
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
terminator 3344..3430
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
regulatory 3492..3520
/label=Pcirc
/note="Pcirc"
/regulatory_class="promoter"
misc_feature 3589..3606
/label=attP
/note="attP"
protein_bind 3698..3714
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
CDS 3810..5783
/codon_start=1
/gene="intB13"
/product="P4-type integrase"
/label=intB13
/protein_id="BAN28914.1"
/translation="MTSIGPKSLLRSLEMALSDLIVRQAKTTGKRYTLYDNDCLSLMVS
AAGGKSWMFRYSWLGKQKRMALGGYPALSLREARAERDKAQALIARGIDPQIERDQRRH
AAKLAGEYTFKNVFDAWVEHRRKELKEGRQSTLSQILRIFNKDVLPTLGKMSIYDIRRP
QLLGVLAAIEKRKAFTTAEKVRTWFNQMFRYALVIAEGLEVNPAADLDVVAEPKPPVAH
NPYLHLPELPEFLQKLRRYNPRGWQTQLGVRLLFLTGVRTGELRLAEPEQFDLDRGFWI
IPPEVVKQLQDEMRKAGKRPQDVPPYIVPLSLQAIEIVRYLLGVMRPAQKYLLSHRSEL
KKRISENTLNKAVQLMGYEGRLTGHGIRGTISTALNEIGYPKIWVDAQLSHSDPNKVSS
AYNHAKYVEPRRRMMQDWADRLDLLEQGEVQAASAHLTIRIDGVPAMAEVEEAVDVAPT
VAEPGVSGSPPVAATPIVVTPNSGGITFQRLSQVPPPPAHAPESEVSAIQREREEMLAM
YESPNNLPVALFGKLAGKSKDQINRELKAGKLLSISLGNRGQRVPDWQLVPLKRRLAQA
LMNQCPHVDSWALYRLLTKPHSNLGNRAAIDVVTPTNVGKVLQAVTPYKEFERSSTDET
PQFSEFVRQLQRHVNALEEAPC"
gene 3810..5783
/gene="intB13"
/label=intB13
misc_feature 6141..6188
/label=FRT
/note="FRT"
protein_bind 6141..6188
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
This page is informational only.