pRhamhIL-10LT vector (V003738)

LOCUS       40924_37033        3343 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pRhamhIL-10LT, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3343)
  AUTHORS   Guggenbichler F, Buttner C, Rudolph W, Zimmermann K, Gunzer F, 
            Pohlmann C.
  TITLE     Design of a covalently linked human interleukin-10 fusion protein 
            and its secretory expression in Escherichia coli
  JOURNAL   Appl. Microbiol. Biotechnol. (2016) In press
  PUBMED    27430741
REFERENCE   2  (bases 1 to 3343)
  AUTHORS   Auerbach C, Guggenbichler F, Buettner C, Rudolph W, Zimmermann K, 
            Gunzer F, Poehlmann C.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JAN-2016) Institute of Medical Microbiology and 
            Hygiene, TU Dresden, Fetscherstrasse 74, Dresden, Saxony 01307, 
            Germany
REFERENCE   3  (bases 1 to 3343)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3343)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Microbiol. Biotechnol. (2016) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-JAN-2016) Institute of Medical Microbiology and Hygiene, TU 
            Dresden, Fetscherstrasse 74, Dresden, Saxony 01307, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3343
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        1..119
                     /label=rhaB promoter
                     /note="promoter of the E. coli rhaBAD operon, conferring
                     tight induction with L-rhamnose and repression with 
                     D-glucose in the presence of RhaR and RhaS (Giacalone et 
                     al., 2006)"
     RBS             153..175
                     /label=RBS
                     /note="efficient ribosome binding site from bacteriophage
                     T7 gene 10 (Olins and Rangwala, 1989)"
     CDS             1254..1271
                     /codon_start=1
                     /label=6xHis
                     /note="6xHis affinity tag"
                     /translation="HHHHHH"
     terminator      1303..1350
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     terminator      1448..1477
                     /label=T3Te terminator
                     /note="phage T3 early transcription terminator"
     rep_origin      1499..2086
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      complement(2098..2125)
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     CDS             complement(2152..2340)
                     /codon_start=1
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     CDS             complement(2344..3156)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNGDRVFRLAQAQSRMNNGLVGA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     promoter        complement(3157..3247)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     terminator      complement(3248..3279)
                     /label=tonB terminator
                     /note="bidirectional E. coli tonB-P14 transcription
                     terminator"