pRGK336 vector (V003743)

LOCUS       40924_36968       11700 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pRGK336, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11700)
  AUTHORS   Engineer CB, Fitzsimmons KC, Schmuke JJ, Dotson SB, Kranz RG.
  TITLE     Development and evaluation of a Gal4-mediated LUC/GFP/GUS enhancer 
            trap system in Arabidopsis
  JOURNAL   BMC Plant Biol. 5, 9 (2005)
  PUBMED    15941484
REFERENCE   2  (bases 1 to 11700)
  AUTHORS   Engineer CB, Fitzsimmons KC, Schmuke J, Dotson S, Kranz RG.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-SEP-2004) Biology, Washington University in St. Louis,
            1 Brookings Drive, Biology 1137, St. Louis, MO 63130-4899, USA
REFERENCE   3  (bases 1 to 11700)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 11700)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "BMC Plant 
            Biol. 5, 9 (2005)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (01-SEP-2004) Biology, Washington University in St. Louis, 1 
            Brookings Drive, Biology 1137, St. Louis, MO 63130-4899, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11700
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(292..316)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     promoter        691..1036
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     CDS             1135..1575
                     /label=GAL4 DNA binding domain
                     /note="DNA binding domain of the GAL4 transcriptional
                     activator"
     CDS             1579..1812
                     /label=VP16 AD
                     /note="transcriptional activation domain of herpes simplex
                     virus protein VP16 (Triezenberg et al., 1988; Cousens et 
                     al., 1989)"
     terminator      1819..2071
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     regulatory      2080..2478
                     /label=full 35S CaMV promoter
                     /note="full 35S CaMV promoter"
                     /regulatory_class="promoter"
     promoter        2319..2365
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     CDS             2478..3026
                     /label=BlpR
                     /note="phosphinothricin acetyltransferase"
     misc_feature    3073..3445
                     /label=7S UTR
                     /note="7S UTR"
     protein_bind    3491..3585
                     /label=5X UAS
                     /note="five tandem copies of the 'ScaI site' 17-mer 
                     CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) 
                     that efficiently binds yeast Gal4 (Webster et al., 1988; 
                     Pfeiffer et al., 2010)"
     promoter        3646..3692
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     CDS             3730..5379
                     /label=luciferase
                     /note="firefly luciferase"
     misc_feature    5425..6383
                     /label=TML
                     /note="TML"
     protein_bind    6411..6681
                     /label=tetracycline response element
                     /note="contains seven copies of the tetracycline operator
                     tetO"
     promoter        6722..6768
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     misc_feature    complement(6769..6793)
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     rep_origin      complement(6959..7672)
                     /direction=LEFT
                     /label=oriV
                     /note="incP origin of replication"
     CDS             8940..9128
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     misc_feature    9233..9373
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(9559..10147)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             10720..11508
                     /codon_start=1
                     /product="spectinomycin/streptomycin resistance"
                     /label=spectinomycin/streptomycin resistance
                     /protein_id="AAY79162.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"