pRGK 367 vector (V003745)

LOCUS       40924_36958       11776 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pRGK 367, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11776)
  AUTHORS   Engineer CB, Kranz RG.
  TITLE     Reciprocal leaf and root expression of AtAmt1.1 and root 
            architectural changes in response to nitrogen starvation
  JOURNAL   Plant Physiol. 143 (1), 236-250 (2007)
  PUBMED    17085512
REFERENCE   2  (bases 1 to 11776)
  AUTHORS   Engineer CB, Kranz RG.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2006) Biology, Washington University in St. Louis,
            1 Brookings Drive, # 1137, St. Louis, MO 63130, USA
REFERENCE   3  (bases 1 to 11776)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 11776)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant 
            Physiol."; date: "2007"; volume: "143"; issue: "1"; pages: "236-250"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (01-JUN-2006) Biology, Washington University in St. Louis, 1 
            Brookings Drive, # 1137, St. Louis, MO 63130, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11776
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(292..316)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     primer_bind     587..603
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    634..907
                     /label=AtAmt1.1 promoter control region
                     /note="AtAmt1.1 promoter control region"
     primer_bind     complement(974..990)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(998..1014)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1022..1052)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     promoter        1064..1110
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     CDS             1211..1651
                     /label=GAL4 DNA binding domain
                     /note="DNA binding domain of the GAL4 transcriptional
                     activator"
     CDS             1655..1888
                     /label=VP16 AD
                     /note="transcriptional activation domain of herpes simplex
                     virus protein VP16 (Triezenberg et al., 1988; Cousens et 
                     al., 1989)"
     terminator      1895..2147
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     regulatory      2156..2554
                     /label=full 35S CaMV promoter
                     /note="full 35S CaMV promoter"
                     /regulatory_class="promoter"
     promoter        2395..2441
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     CDS             2554..3102
                     /label=BlpR
                     /note="phosphinothricin acetyltransferase"
     misc_feature    3149..3521
                     /label=7S UTR
                     /note="7S UTR"
     protein_bind    3567..3661
                     /label=5X UAS
                     /note="five tandem copies of the 'ScaI site' 17-mer 
                     CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) 
                     that efficiently binds yeast Gal4 (Webster et al., 1988; 
                     Pfeiffer et al., 2010)"
     regulatory      3670..3766
                     /label=minimal 35S CaMV promoter element
                     /note="minimal 35S CaMV promoter element"
                     /regulatory_class="promoter"
     promoter        3722..3768
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     CDS             3806..5455
                     /label=luciferase
                     /note="firefly luciferase"
     misc_feature    5501..6460
                     /label=TML cassette
                     /note="TML cassette"
     protein_bind    6487..6757
                     /label=tetracycline response element
                     /note="contains seven copies of the tetracycline operator
                     tetO"
     promoter        6798..6844
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     misc_feature    complement(6845..6869)
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     rep_origin      complement(7035..7748)
                     /direction=LEFT
                     /label=oriV
                     /note="incP origin of replication"
     CDS             9016..9204
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     misc_feature    9309..9449
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(9635..10223)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             10796..11584
                     /codon_start=1
                     /gene="spc/str"
                     /product="spectinomycin/streptomycin resistance"
                     /label=spc/str
                     /protein_id="ABG75725.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            10796..11584
                     /gene="spc/str"
                     /label=spc/str