pQUAST vector (V003843)

LOCUS       40924_36268        8950 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pQUAST, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8950)
  AUTHORS   Potter CJ, Tasic B, Russler EV, Liang L, Luo L.
  TITLE     The Q system: a repressible binary system for transgene expression, 
            lineage tracing, and mosaic analysis
  JOURNAL   Cell 141 (3), 536-548 (2010)
  PUBMED    20434990
REFERENCE   2  (bases 1 to 8950)
  AUTHORS   Potter CJ, Tasic B, Luo L.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-APR-2010) Neuroscience, The Johns Hopkins School of 
            Medicine, 855 N. Wolfe Street, Baltimore, MD 21205, USA
REFERENCE   3  (bases 1 to 8950)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8950)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Cell"; 
            date: "2010"; volume: "141"; issue: "3"; pages: "536-548"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-APR-2010) Neuroscience, The Johns Hopkins School of Medicine, 
            855 N. Wolfe Street, Baltimore, MD 21205, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8950
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(235..823)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(997..1854)
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(1855..1959)
                     /label=AmpR promoter
     misc_feature    complement(2761..2993)
                     /label=P element 3' end
                     /note="P element 3' end"
     misc_feature    3047..3140
                     /label=5XQUAS
                     /note="5XQUAS"
     promoter        3189..3427
                     /label=hsp70 promoter
                     /note="Drosophila melanogaster hsp70Bb promoter"
     misc_feature    3441..3511
                     /label=multi-cloning site
                     /note="multi-cloning site"
     intron          3588..3653
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             3783..3803
                     /codon_start=1
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /translation="PKKKRKV"
     polyA_signal    4075..4209
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     gene            4227..8354
                     /label=mini-white
                     /note="This modified version of the white gene lacks part
                     of the first intron."
     misc_feature    complement(8365..8950)
                     /label=P element 5' end