Basic Vector Information
- Vector Name:
- pP{CaSpeR4-lo-}
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7857 bp
- Type:
- P-element cloning system vector
- Replication origin:
- ori
- Source/Author:
- Roman G, Endo K, Zong L, Davis RL.
pP{CaSpeR4-lo-} vector Map
pP{CaSpeR4-lo-} vector Sequence
LOCUS 40924_35863 7857 bp DNA circular SYN 18-DEC-2018
DEFINITION P-element cloning system vector pP{CaSpeR4-lo-}, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7857)
AUTHORS Roman G, Endo K, Zong L, Davis RL.
TITLE P[Switch], a system for spatial and temporal control of gene
expression in Drosophila melanogaster
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (22), 12602-12607 (2001)
PUBMED 11675496
REFERENCE 2 (bases 1 to 7857)
AUTHORS Roman G, Davis RL.
TITLE Conditional expression of UAS-transgenes in the adult eye with a new
gene-switch vector system
JOURNAL Genesis 34 (1-2), 127-131 (2002)
PUBMED 12324966
REFERENCE 3 (bases 1 to 7857)
AUTHORS Roman G, Davis RL.
TITLE Direct Submission
JOURNAL Submitted (25-JUN-2002) Molecular and Cellular Biology, Baylor
College of Medicine, One Baylor Plaza, Houston, TX 77030, USA
REFERENCE 4 (bases 1 to 7857)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 7857)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "2001"; volume: "98"; issue: "22"; pages:
"12602-12607"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Genesis 34
(1-2), 127-131 (2002)"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(25-JUN-2002) Molecular and Cellular Biology, Baylor College of
Medicine, One Baylor Plaza, Houston, TX 77030, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7857
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..586
/label=P element 5' end
gene complement(597..4733)
/label=mini-white
/note="This modified version of the white gene lacks part
of the first intron."
protein_bind 4738..4771
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
misc_feature 4865..5097
/label=P element 3' end
/note="P element 3' end"
misc_feature 5098..5598
/label=white linker sequence
/note="white linker sequence"
promoter 5899..6003
/label=AmpR promoter
CDS 6004..6861
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 7035..7623
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 7629..7857
/label=white linker sequence
/note="white linker sequence"
This page is informational only.