Basic Vector Information
- Vector Name:
- pPVLUC441
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6320 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hashinaka K.
pPVLUC441 vector Map
pPVLUC441 vector Sequence
LOCUS 40924_35703 6320 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPVLUC441 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6320)
AUTHORS Hashinaka K.
TITLE Synthetic Autonomous Vectors Based on Palindromic Sequences of
Parvovirus B19
JOURNAL Published Only in Database (2001)
REFERENCE 2 (bases 1 to 6320)
AUTHORS Hashinaka K.
TITLE Direct Submission
JOURNAL Submitted (21-FEB-2000) Kazuya Hashinaka, Miyazaki Medical College,
Department of Biochemistry; 5200 Kihara, Kiyotake, Miyazaki
889-1692, Japan (E-mail:hasinaka@post1.miyazaki-med.ac.jp,
Tel:81-985-85-0985, Fax:81-985-85-2401)
REFERENCE 3 (bases 1 to 6320)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6320)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Published
Only in Database (2001)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-FEB-2000) Kazuya Hashinaka, Miyazaki Medical College, Department
of Biochemistry"; volume: " 5200 Kihara, Kiyotake, Miyazaki
889-1692, Japan (E-mail:hasinaka@post1.miyazaki-med.ac.jp,
Tel:81-985-85-0985, Fax"; pages: "81-985-85-2401"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6320
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 6..479
/mol_type="other DNA"
/label=synonym:Parvovirus B19
/note="synonym:Parvovirus B19"
/db_xref="taxon:10798"
/organism="Human parvovirus B19"
source 2937..3420
/mol_type="other DNA"
/label=synonym:Parvovirus B19
/note="synonym:Parvovirus B19"
/db_xref="taxon:10798"
/organism="Human parvovirus B19"
repeat_region 9..391
promoter 522..720
/label=SV40 promoter
/note="SV40 early promoter"
regulatory 750..759
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
CDS 1347..2414
/codon_start=1
/gene="luc"
/product="luciferase"
/label=luc
/protein_id="BAB32737.1"
/translation="MNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV
VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKST
LIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDK
PGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGW
LHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDD
AGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKI
REILIKAKKGGKIAV"
gene 1347..2414
/gene="luc"
/label=luc
polyA_signal complement(2455..2576)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
repeat_region 3029..3411
promoter complement(3429..3447)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(3454..3470)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 3611..4066
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 4147..4251
/label=AmpR promoter
CDS 4252..5109
/label=AmpR
/note="beta-lactamase"
rep_origin 5283..5871
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 6159..6180
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 6195..6225
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 6233..6249
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 6257..6273
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 6291..6309
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.