Basic Vector Information
- Vector Name:
- pPV472
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7405 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Massey HC Jr., Ranjit N, Stoltzfus JD, Lok JB.
pPV472 vector Map
pPV472 vector Sequence
LOCUS 40924_35668 7405 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pPV472, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7405)
AUTHORS Massey HC Jr., Ranjit N, Stoltzfus JD, Lok JB.
TITLE Strongyloides stercoralis daf-2 encodes a divergent ortholog of
Caenorhabditis elegans DAF-2
JOURNAL Int. J. Parasitol. 43 (7), 515-520 (2013)
PUBMED 23500073
REFERENCE 2 (bases 1 to 7405)
AUTHORS Massey HC Jr., Ranjit N, Stoltzfus JD, Castelletto ML, Lok JB.
TITLE Direct Submission
JOURNAL Submitted (11-DEC-2012) Pathobiology, University of Pennsylvania
Veterinary School, 3800 Spruce Street, Philadelphia, PA 19104, USA
REFERENCE 3 (bases 1 to 7405)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7405)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Int. J.
Parasitol."; date: "2013"; volume: "43"; issue: "7"; pages:
"515-520"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-DEC-2012) Pathobiology, University of Pennsylvania Veterinary
School, 3800 Spruce Street, Philadelphia, PA 19104, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7405
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 107..128
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 143..173
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 181..197
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 205..221
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 242..260
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
regulatory 295..2250
/note="derived from Strongyloides stercoralis daf-2
promoter region"
/regulatory_class="promoter"
CDS join(2251..2421,2473..2626,2678..2841,2893..3120)
/codon_start=1
/product="GFP"
/label=GFP
/note="green fluorescent protein"
/protein_id="AGH70233.1"
/translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
FVTAAGITHGMDELYK"
regulatory 3129..3721
/note="derived from Strongyloides stercoralis era-1
terminator"
/regulatory_class="terminator"
protein_bind complement(3723..3743)
/label=attB3
/note="core recombination site for the Gateway(R) BP
reaction"
promoter complement(3778..3796)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(3803..3819)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS 3957..4256
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
CDS 4608..5399
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
CDS complement(5655..6512)
/label=AmpR
/note="beta-lactamase"
rep_origin 6636..7224
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.