Basic Vector Information
- Vector Name:
- pPLV04_v2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6753 bp
- Type:
- Cloning vector
- Replication origin:
- pSa ori
- Source/Author:
- Wendrich JR, Liao CY, van den Berg WA, De Rybel B, Weijers D.
pPLV04_v2 vector Map
pPLV04_v2 vector Sequence
LOCUS 40924_35099 6753 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPLV04_v2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6753)
AUTHORS Wendrich JR, Liao CY, van den Berg WA, De Rybel B, Weijers D.
TITLE Ligation-independent cloning for plant research
JOURNAL Methods Mol. Biol. 1284, 421-431 (2015)
PUBMED 25757785
REFERENCE 2 (bases 1 to 6753)
AUTHORS Wendrich JR, Liao C-Y., van den Berg WAM., De Rybel B, Weijers D.
TITLE Direct Submission
JOURNAL Submitted (25-JUN-2014) Laboratory of Biochemistry, Wageningen
University, Dreijenlaan 3, Wageningen 6703HA, The Netherlands
REFERENCE 3 (bases 1 to 6753)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6753)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods
Mol. Biol. 1284, 421-431 (2015)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(25-JUN-2014) Laboratory of Biochemistry, Wageningen University,
Dreijenlaan 3, Wageningen 6703HA, The Netherlands"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6753
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(66..654)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(828..1640)
/label=KanR
/note="aminoglycoside phosphotransferase"
rep_origin 1931..2366
/label=pSa ori
/note="origin of replication from bacterial plasmid pSa"
misc_feature 2493..2515
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA
(truncated)"
terminator complement(2539..2791)
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
CDS complement(2834..3625)
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
promoter complement(3659..3838)
/label=NOS promoter
/note="nopaline synthase promoter"
primer_bind 4085..4101
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 4111..4129
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind 4155..4171
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 4192..4221
/note="LIC; ligation-independent cloning (LIC) site"
CDS 4234..4254
/codon_start=1
/product="nuclear localization signal of SV40 (simian virus
40) large T antigen"
/label=SV40 NLS
/translation="PKKKRKV"
CDS 4255..4971
/label=EGFP
/note="enhanced GFP"
CDS 4978..5694
/codon_start=1
/product="enhanced GFP"
/label=EGFP
/note="mammalian codon-optimized"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK"
CDS 5701..6420
/codon_start=1
/product="enhanced GFP"
/label=EGFP
/note="mammalian codon-optimized"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK"
terminator 6434..6682
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
misc_feature 6704..6728
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
This page is informational only.