Basic Vector Information
- Vector Name:
- pPLEX-505
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10862 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM.
pPLEX-505 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPLEX-505 vector Sequence
LOCUS 40924_35049 10862 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPLEX-505, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10862) AUTHORS Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM. TITLE A suite of novel promoters and terminators for plant biotechnology JOURNAL Funct. Plant Biol. 30, 443-452 (2003) REFERENCE 2 (bases 1 to 10862) AUTHORS Schunmann PHD. TITLE Direct Submission JOURNAL Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra, ACT 2602, Australia REFERENCE 3 (bases 1 to 10862) TITLE Direct Submission REFERENCE 4 (bases 1 to 10862) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct. Plant Biol. 30, 443-452 (2003)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra, ACT 2602, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10862 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 168..192 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin 672..1385 /label=oriV /note="incP origin of replication" CDS complement(1990..2778) /codon_start=1 /product="spectinomycin resistant protein" /label=spectinomycin resistant protein /protein_id="AAP22305.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 3875..4463 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5826..6971) /label=trfA /note="trans-acting replication protein that binds to and activates oriV" CDS complement(7246..7596) /label=traJ /note="oriT-recognizing protein" mobile_element complement(7596..8363) /label=IS1 /note="prokaryotic transposable element" oriT complement(8423..8532) /direction=LEFT /label=oriT /note="incP origin of transfer" misc_feature 9087..9111 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" regulatory 9195..9717 /note="S1 promoter derived from subterranean clover stunt virus DNA segment 1" /regulatory_class="promoter" CDS 9727..10518 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory 10703..10841 /note="S3 terminator derived from subterranean clover stunt virus DNA segment 3" /regulatory_class="terminator"
This page is informational only.