pPLEX-5031 vector (V004014)

MSDS

Basic Vector Information

Vector Name:: pPLEX-5031

Length:: 14033 bp

Type:: Cloning vector

Replication origin:: oriV

Host:: Plants

Source/Author:: Schunmann PHD., Surin B, Waterhouse PM.

Promoter:: CaMV 35S

pPLEX-5031 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pPLEX-5031 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_35039       14033 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPLEX-5031, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14033)
  AUTHORS   Schunmann PHD., Surin B, Waterhouse PM.
  TITLE     A suite of novel promoters and terminators for plant biotechnology. 
            II. The pPLEX series for use in monocots
  JOURNAL   Funct. Plant Biol. 30, 453-460 (2003)
REFERENCE   2  (bases 1 to 14033)
  AUTHORS   Schunmann PHD.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2003) CSIRO Plant Industry, GPO Box 1600, 
            Canberra, ACT 2617, Australia
REFERENCE   3  (bases 1 to 14033)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 14033)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Funct. 
            Plant Biol. 30, 453-460 (2003)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-JAN-2003) CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 
            2617, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..14033
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      21..565
                     /note="S4 promoter derived from subterranean clover stunt
                     virus DNA segment 4"
                     /regulatory_class="promoter"
     intron          609..1618
                     /number=1
                     /note="ubiquitin; Ubi1"
     misc_feature    1639..1680
                     /note="multiple cloning site; MCS"
     regulatory      1681..2574
                     /note="Me1 terminator derived from Flavaria bidentis NADP
                     malic gene"
                     /regulatory_class="terminator"
     promoter        2723..3067
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     intron          3416..3605
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     terminator      4333..4585
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     promoter        complement(4655..4838)
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     misc_feature    4994..5018
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      5499..6212
                     /label=oriV
                     /note="incP origin of replication"
     CDS             complement(6817..7605)
                     /codon_start=1
                     /product="spectinomycin resistant protein"
                     /label=spectinomycin resistant protein
                     /protein_id="AAP23189.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      8702..9290
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(10653..11798)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(12073..12423)
                     /label=traJ
                     /note="oriT-recognizing protein"
     mobile_element  complement(12423..13190)
                     /label=IS1
                     /note="prokaryotic transposable element"
     oriT            complement(13250..13359)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     misc_feature    13914..13938
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"

This page is informational only.