Basic Vector Information
- Vector Name:
- pPLEX-5003
- Length:
- 12977 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Schunmann PHD., Surin B, Waterhouse PM.
- Promoter:
- CaMV 35S
pPLEX-5003 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPLEX-5003 vector Sequence
LOCUS 40924_35004 12977 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPLEX-5003, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12977) AUTHORS Schunmann PHD., Surin B, Waterhouse PM. TITLE A suite of novel promoters and terminators for plant biotechnology. II. The pPLEX series for use in monocots JOURNAL Funct. Plant Biol. 30, 453-460 (2003) REFERENCE 2 (bases 1 to 12977) AUTHORS Schunmann PHD. TITLE Direct Submission JOURNAL Submitted (23-JAN-2003) CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 2617, Australia REFERENCE 3 (bases 1 to 12977) TITLE Direct Submission REFERENCE 4 (bases 1 to 12977) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct. Plant Biol. 30, 453-460 (2003)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-JAN-2003) CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 2617, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12977 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 23..576 /note="S7 promoter derived from subterranean clover stunt virus DNA segment 7" /regulatory_class="promoter" misc_feature 577..624 /note="multiple cloning site; MCS" regulatory 625..1518 /note="Me1 terminator derived from Flavaria bidentis NADP malic gene" /regulatory_class="terminator" promoter 1667..2011 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" intron 2360..2549 /label=cat1 intron /note="castor bean catalase intron, modified" terminator 3277..3529 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" promoter complement(3599..3782) /label=NOS promoter /note="nopaline synthase promoter" misc_feature 3938..3962 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin 4443..5156 /label=oriV /note="incP origin of replication" CDS complement(5761..6549) /codon_start=1 /product="spectinomycin resistant protein" /label=spectinomycin resistant protein /protein_id="AAP23174.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 7646..8234 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9597..10742) /label=trfA /note="trans-acting replication protein that binds to and activates oriV" CDS complement(11017..11367) /label=traJ /note="oriT-recognizing protein" mobile_element complement(11367..12134) /label=IS1 /note="prokaryotic transposable element" oriT complement(12194..12303) /direction=LEFT /label=oriT /note="incP origin of transfer" misc_feature 12858..12882 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA"
This page is informational only.