pPLEX-4001 vector (V004026)

LOCUS       40924_34979       12377 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPLEX-4001, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12377)
  AUTHORS   Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, 
            Waterhouse PM.
  TITLE     A suite of novel promoters and terminators for plant biotechnology
  JOURNAL   Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE   2  (bases 1 to 12377)
  AUTHORS   Schunmann PHD.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, 
            Canberra, ACT 2602, Australia
REFERENCE   3  (bases 1 to 12377)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12377)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Funct. 
            Plant Biol. 30, 443-452 (2003)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra, 
            ACT 2602, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12377
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      21..565
                     /note="S4 promoter derived from subterranean clover stunt
                     virus DNA segment 4"
                     /regulatory_class="promoter"
     misc_feature    566..613
                     /note="multiple cloning site; MCS"
     regulatory      614..1507
                     /note="Me1 terminator derived from Flavaria bidentis NADP
                     malic enzyme gene"
                     /regulatory_class="terminator"
     misc_feature    1683..1707
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      2187..2900
                     /label=oriV
                     /note="incP origin of replication"
     CDS             complement(3505..4293)
                     /codon_start=1
                     /product="spectinomycin resistant protein"
                     /label=spectinomycin resistant protein
                     /protein_id="AAP22321.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      5390..5978
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7341..8486)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(8761..9111)
                     /label=traJ
                     /note="oriT-recognizing protein"
     mobile_element  complement(9111..9878)
                     /label=IS1
                     /note="prokaryotic transposable element"
     oriT            complement(9938..10047)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     misc_feature    10602..10626
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     regulatory      10710..11232
                     /note="S1 promoter derived from subterranean clover stunt
                     virus DNA segment 1"
                     /regulatory_class="promoter"
     CDS             11242..12033
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     regulatory      12218..12356
                     /note="S3 terminator derived from subterranean clover stunt
                     virus DNA segment 3"
                     /regulatory_class="terminator"