pPLEX-4001 vector (V004026)

Basic Vector Information

Vector Name:
pPLEX-4001
Antibiotic Resistance:
Kanamycin
Length:
12377 bp
Type:
Cloning vector
Replication origin:
oriV
Source/Author:
Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM.

pPLEX-4001 vector Vector Map

pPLEX-400112377 bp60012001800240030003600420048005400600066007200780084009000960010200108001140012000S4 promoter derived from subterranean clover stunt virus DNA segment 4multiple cloning site; MCSMe1 terminator derived from Flavaria bidentis NADP malic enzyme geneRB T-DNA repeatoriVspectinomycin resistant proteinoritrfAtraJIS1oriTLB T-DNA repeatS1 promoter derived from subterranean clover stunt virus DNA segment 1NeoR/KanRS3 terminator derived from subterranean clover stunt virus DNA segment 3

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pPLEX-4001 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_34979       12377 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPLEX-4001, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12377)
  AUTHORS   Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, 
            Waterhouse PM.
  TITLE     A suite of novel promoters and terminators for plant biotechnology
  JOURNAL   Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE   2  (bases 1 to 12377)
  AUTHORS   Schunmann PHD.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, 
            Canberra, ACT 2602, Australia
REFERENCE   3  (bases 1 to 12377)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12377)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Funct. 
            Plant Biol. 30, 443-452 (2003)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra, 
            ACT 2602, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12377
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      21..565
                     /note="S4 promoter derived from subterranean clover stunt
                     virus DNA segment 4"
                     /regulatory_class="promoter"
     misc_feature    566..613
                     /note="multiple cloning site; MCS"
     regulatory      614..1507
                     /note="Me1 terminator derived from Flavaria bidentis NADP
                     malic enzyme gene"
                     /regulatory_class="terminator"
     misc_feature    1683..1707
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      2187..2900
                     /label=oriV
                     /note="incP origin of replication"
     CDS             complement(3505..4293)
                     /codon_start=1
                     /product="spectinomycin resistant protein"
                     /label=spectinomycin resistant protein
                     /protein_id="AAP22321.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      5390..5978
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7341..8486)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(8761..9111)
                     /label=traJ
                     /note="oriT-recognizing protein"
     mobile_element  complement(9111..9878)
                     /label=IS1
                     /note="prokaryotic transposable element"
     oriT            complement(9938..10047)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     misc_feature    10602..10626
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     regulatory      10710..11232
                     /note="S1 promoter derived from subterranean clover stunt
                     virus DNA segment 1"
                     /regulatory_class="promoter"
     CDS             11242..12033
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     regulatory      12218..12356
                     /note="S3 terminator derived from subterranean clover stunt
                     virus DNA segment 3"
                     /regulatory_class="terminator"

This page is informational only.