Basic Vector Information
- Vector Name:
- pPLEX-3002
- Length:
- 13015 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM.
pPLEX-3002 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPLEX-3002 vector Sequence
LOCUS 40924_34964 13015 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPLEX-3002, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 13015)
AUTHORS Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC,
Waterhouse PM.
TITLE A suite of novel promoters and terminators for plant biotechnology
JOURNAL Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE 2 (bases 1 to 13015)
AUTHORS Schunmann PHD.
TITLE Direct Submission
JOURNAL Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street,
Canberra, ACT 2602, Australia
REFERENCE 3 (bases 1 to 13015)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 13015)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct.
Plant Biol. 30, 443-452 (2003)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra,
ACT 2602, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..13015
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 21..1013
/note="S4S4 promoter derived from subterranean clover stunt
virus DNA segment 4"
/regulatory_class="promoter"
misc_feature 1014..1061
/note="multiple cloning site; MCS"
regulatory 1062..1955
/note="Me1 terminator derived from Flavaria bidentis NADP
malic enzyme gene"
/regulatory_class="terminator"
misc_feature 2131..2155
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
rep_origin 2635..3348
/label=oriV
/note="incP origin of replication"
CDS complement(3953..4741)
/codon_start=1
/product="spectinomycin resistant protein"
/label=spectinomycin resistant protein
/protein_id="AAP22311.1"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin 5838..6426
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7789..8934)
/label=trfA
/note="trans-acting replication protein that binds to and
activates oriV"
CDS complement(9209..9559)
/label=traJ
/note="oriT-recognizing protein"
mobile_element complement(9559..10326)
/label=IS1
/note="prokaryotic transposable element"
oriT complement(10386..10495)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
misc_feature 11050..11074
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
regulatory 11158..11680
/note="S1 promoter derived from subterranean clover stunt
virus DNA segment 1"
/regulatory_class="promoter"
intron 11873..12062
/label=cat1 intron
/note="castor bean catalase intron, modified"
regulatory 12856..12994
/note="S3 terminator derived from subterranean clover stunt
virus DNA segment 3"
/regulatory_class="terminator"
This page is informational only.