Basic Vector Information
- Vector Name:
- pPLEX-3001
- Length:
- 12567 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM.
pPLEX-3001 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPLEX-3001 vector Sequence
LOCUS 40924_34959 12567 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPLEX-3001, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12567)
AUTHORS Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC,
Waterhouse PM.
TITLE A suite of novel promoters and terminators for plant biotechnology
JOURNAL Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE 2 (bases 1 to 12567)
AUTHORS Schunmann PHD.
TITLE Direct Submission
JOURNAL Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street,
Canberra, ACT 2602, Australia
REFERENCE 3 (bases 1 to 12567)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12567)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct.
Plant Biol. 30, 443-452 (2003)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra,
ACT 2602, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12567
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 21..565
/note="S4 promoter derived from subterranean clover stunt
virus DNA segment 4"
/regulatory_class="promoter"
misc_feature 566..613
/note="multiple cloning site; MCS"
regulatory 614..1507
/note="Me1 terminator derived from Flavaria bidentis NADP
malic enzyme gene"
/regulatory_class="terminator"
misc_feature 1683..1707
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
rep_origin 2187..2900
/label=oriV
/note="incP origin of replication"
CDS complement(3505..4293)
/codon_start=1
/product="spectinomycin resistant protein"
/label=spectinomycin resistant protein
/protein_id="AAP22309.1"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin 5390..5978
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7341..8486)
/label=trfA
/note="trans-acting replication protein that binds to and
activates oriV"
CDS complement(8761..9111)
/label=traJ
/note="oriT-recognizing protein"
mobile_element complement(9111..9878)
/label=IS1
/note="prokaryotic transposable element"
oriT complement(9938..10047)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
misc_feature 10602..10626
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
regulatory 10710..11232
/note="S1 promoter derived from subterranean clover stunt
virus DNA segment 1"
/regulatory_class="promoter"
intron 11425..11614
/label=cat1 intron
/note="castor bean catalase intron, modified"
regulatory 12408..12546
/note="S3 terminator derived from subterranean clover stunt
virus DNA segment 3"
/regulatory_class="terminator"
This page is informational only.