pPLaA17 vector (V004040)

LOCUS       V004040                 5241 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004040
VERSION     V004040
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5241)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5241)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 5241)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5241)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
            9052, BELGIUM"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5241
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      complement(117..247)
                     /label="PL promoter"
                     /note="PL promoter"
                     /regulatory_class="promoter"
     CDS             615..1427
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"
     rep_origin      complement(1889..2477)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(2651..3508)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(3509..3613)
                     /label="AmpR promoter"
     misc_feature    3717..3740
                     /label="5' UTR of A"
                     /note="5' UTR of A"
     CDS             3741..4919
                     /gene="A"
                     /label="Maturation protein A"
                     /note="Maturation protein A from Escherichia phage MS2.
                     Accession#: P03610"
     misc_feature    4923..4945
                     /label="5' UTR of COAT"
                     /note="5' UTR of COAT"
     CDS             4946..5241
                     /codon_start=1
                     /note="unnamed protein product; COATf"
                     /protein_id="SJL88839.1"
                     /translation="MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKV
                     TCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFAT"