Basic Vector Information
- Vector Name:
- pPIPRA721
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10297 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB.
- Promoter:
- MAS
pPIPRA721 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPIPRA721 vector Sequence
LOCUS 40924_34709 10297 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPIPRA721, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10297) AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB. TITLE Constitutive expression of eIF5A3 increases high quality biomass yield in an elite alfalfa cultivar JOURNAL Unpublished REFERENCE 2 (bases 1 to 10297) AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB. TITLE Direct Submission JOURNAL Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, CA 95616, USA REFERENCE 3 (bases 1 to 10297) TITLE Direct Submission REFERENCE 4 (bases 1 to 10297) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, CA 95616, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10297 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 26..406 /label=MAS promoter /note="mannopine synthase promoter (Velten et al., 1984)" CDS 420..1142 /codon_start=1 /gene="ipt" /product="isopentenyl phosphotransferase" /label=ipt /note="involved in condensation of AMP and isopentenylpyrophosphate to form isopentenyl-AMP" /protein_id="AKE42824.1" /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP QVNAAAFDGFEGHPFGMY" gene 420..1142 /gene="ipt" /label=ipt terminator 1505..1757 /label=MAS terminator /note="mannopine synthase terminator" misc_feature 1782..1949 /label=T-DNA left border /note="T-DNA left border" regulatory 1975..2556 /label=histone H3 /note="histone H3" /regulatory_class="promoter" CDS 2598..3077 /codon_start=1 /gene="eIF5A3" /product="eukaryotic translation initiation factor 5A" /label=eIF5A3 /note="eIF5A3; derived from Populus deltoides" /protein_id="AKE42825.1" /translation="MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEV STSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSL LTENGNTKDDLRLPTDESLLSQIKDGFGEGKDLVVTVMSSMGEEQICALKDVGPK" gene 2598..3077 /gene="eIF5A3" /label=eIF5A3 /note="PdeIF5A3" regulatory 3100..3403 /label=pea E9 /note="pea E9" /regulatory_class="terminator" misc_feature 3434..3642 /label=T-DNA left border /note="T-DNA left border" CDS 4981..5607 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 6039..7109 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 7178..7372 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 7846..7986 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8172..8760) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9228..10019) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.