pPIPRA719 vector (V004085)

LOCUS       40924_34704       13015 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPIPRA719, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13015)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, 
            Johnson D, Reich J, Bennett AB.
  TITLE     Constitutive expression of eIF5A3 increases high quality biomass 
            yield in an elite alfalfa cultivar
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 13015)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, 
            Johnson D, Reich J, Bennett AB.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields 
            Avenue, Davis, CA 95616, USA
REFERENCE   3  (bases 1 to 13015)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13015)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, 
            CA 95616, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13015
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        26..406
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     CDS             420..1142
                     /codon_start=1
                     /gene="ipt"
                     /product="isopentenyl phosphotransferase"
                     /label=ipt
                     /note="involved in condensation of AMP and 
                     isopentenylpyrophosphate to form isopentenyl-AMP"
                     /protein_id="AKE42814.1"
                     /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS
                     GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN
                     CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR
                     LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP
                     QVNAAAFDGFEGHPFGMY"
     gene            420..1142
                     /gene="ipt"
                     /label=ipt
     terminator      1505..1757
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     misc_feature    1782..1949
                     /label=T-DNA left border
                     /note="T-DNA left border"
     regulatory      1974..2372
                     /label=mas
                     /note="mas"
                     /regulatory_class="promoter"
     promoter        1984..2364
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     CDS             2384..3172
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     regulatory      3182..3458
                     /label=mas
                     /note="mas"
                     /regulatory_class="terminator"
     terminator      3193..3445
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     regulatory      3502..4445
                     /label=FMV34S
                     /note="FMV34S"
                     /regulatory_class="promoter"
     CDS             4512..5792
                     /label=codA
                     /note="E. coli cytosine deaminase"
     regulatory      5810..6110
                     /label=pea E9
                     /note="pea E9"
                     /regulatory_class="terminator"
     misc_feature    6154..6362
                     /label=T-DNA left border
                     /note="T-DNA left border"
     CDS             7699..8325
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             8757..9827
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      9896..10090
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    10564..10704
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(10890..11478)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(11946..12737)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"