Basic Vector Information
- Vector Name:
- pPAL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3407 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kobayashi H.
pPAL vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPAL vector Sequence
LOCUS 40924_34056 3407 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pPAL DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3407) AUTHORS Kobayashi H. TITLE Inducible suppression of global translation by overuse of rare codons JOURNAL Appl. Environ. Microbiol. 81 (7), 2544-2553 (2015) PUBMED 25636849 REFERENCE 2 (bases 1 to 3407) AUTHORS Kobayashi H. TITLE Direct Submission JOURNAL Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/ REFERENCE 3 (bases 1 to 3407) TITLE Direct Submission REFERENCE 4 (bases 1 to 3407) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2015"; volume: "81"; issue: "7"; pages: "2544-2553" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-JAN-2015) Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3407 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 200..913 /codon_start=1 /label=yeGFP /note="yeast-enhanced green fluorescent protein" /translation="MSKGEELFTGVVPILVELDGDVNGQKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFYKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKPKNGIKV NFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLE FVTAAGITHGMDELYK" terminator 1127..1213 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1305..1332 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 1352..1443 /label=AmpR promoter CDS 1444..2301 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 2334..2428 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 2516..3104 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(3268..3354) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.