pFF706 vector (V006281)

LOCUS       V006281                 8509 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V006281
VERSION     V006281
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8509)
  AUTHORS   Farzadfard F, Lu TK.
  TITLE     Synthetic biology. Genomically encoded analog memory with precise in
            vivo DNA writing in living cell populations
  JOURNAL   Science 346 (6211), 1256272 (2014)
   PUBMED   25395541
REFERENCE   2  (bases 1 to 8509)
  AUTHORS   Farzadfard F, Lu T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2014) Biological Engineering, MIT, 77
            Massachusetts Avenue, NE47, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 8509)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8509)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Science";
            date: "2014"; volume: "346"; issue: "6211"; pages: "1256272"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (04-DEC-2014) Biological Engineering, MIT, 77 Massachusetts Avenue,
            NE47, Cambridge, MA 02139, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8509
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(42..184)
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     CDS             complement(289..477)
                     /label="rop"
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     CDS             complement(1281..1895)
                     /gene="fixJ"
                     /label="Transcriptional regulatory protein FixJ"
                     /note="Transcriptional regulatory protein FixJ from
                     Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC
                     13528 / IAM 13628 / NBRC 14792 / USDA 110). Accession#:
                     P23221"
     CDS             complement(1892..3034)
                     /codon_start=1
                     /product="YF1"
                     /label="YF1"
                     /protein_id="AIZ09121.1"
                     /translation="MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQG
                     FVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWN
                     ELNIDPMEIEDKTYFVGIQNDITEHQQTQARLQELQSELVHVSRLSAMGEMASALAHEL
                     NQPLAAISNYMKGSRRLLAGSSDPNTPKVESALDRAAEQALRAGQIIRRLRDFVARGES
                     EKRVESLSKLIEEAGALGLAGAREQNVQLRFSLDPGADLVLADRVQIQQVLVNLFRNAL
                     EAMAQSQRRELVVTNTPAADDMIEVEVSDTGSGFQDDVIPNLFQTFFTTKDTGMGVGLS
                     ISRSIIEAHGGRMWAESNASGGATFRFTLPAADEMIGGLA"
     promoter        complement(3035..3112)
                     /label="lacIq promoter"
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     regulatory      3407..3653
                     /label="FixK2 promoter"
                     /note="FixK2 promoter"
                     /regulatory_class="promoter"
     RBS             3660..3671
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             3678..4388
                     /label="lambda repressor"
                     /note="phage lambda repressor"
     CDS             4389..4421
                     /label="ssrA tag (LVA)"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      4469..4540
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      4556..4583
                     /label="T7Te terminator"
                     /note="phage T7 early transcription terminator"
     regulatory      4598..4646
                     /label="lambda pR promoter"
                     /note="lambda pR promoter"
                     /regulatory_class="promoter"
     misc_feature    4655..4736
                     /note="primer for the Ec86 RT; msr"
     misc_feature    complement(4726..4856)
                     /note="template for Ec86 RT; msd(kanR_ON)"
     CDS             4876..5835
                     /gene="ret"
                     /label="Retron Ec86 reverse transcriptase"
                     /note="Retron Ec86 reverse transcriptase from Escherichia
                     coli. Accession#: P23070"
     CDS             5875..6657
                     /label="Beta"
                     /note="single-stranded DNA binding recombinase in the
                     lambda Red system"
     terminator      6678..6764
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     rep_origin      complement(6928..7516)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     terminator      complement(7604..7698)
                     /label="lambda t0 terminator"
                     /note="transcription terminator from phage lambda"
     CDS             complement(7722..8378)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(8379..8481)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"