pET21-vioE vector (Cat. No.: V006484)
Basic Information
- Name:
- pET21-vioE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6042 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Pardee K, Slomovic S, Nguyen PQ, Lee JW, Donghia N, Burrill D, Ferrante T, McSorley F, Furuta Y, Lewandowski M, Boddy CN, Joshi NS, Collins JJ.
pET21-vioE vector (Cat. No.: V006484) Sequence
LOCUS 40924_18346 6042 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pET21-vioE, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6042)
AUTHORS Pardee K, Slomovic S, Nguyen PQ, Lee JW, Donghia N, Burrill D,
Ferrante T, McSorley F, Furuta Y, Lewandowski M, Boddy CN, Joshi NS,
Collins JJ.
TITLE Portable, On-demand Biomolecular Manufacturing
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6042)
AUTHORS Pardee K, Slomovic S, Nguyen PQ, Lee JW, Donghia N, Burrill D,
Ferrante T, McSorley F, Furuta Y, Lewandowski M, Boddy CN, Joshi NS,
Collins JJ.
TITLE Direct Submission
JOURNAL Submitted (29-JUN-2016) Wyss Institute, Harvard University, 3
Blackfan Circle, Wyss Institute Rm517-1D, Boston, MA 02115, USA
REFERENCE 3 (bases 1 to 6042)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6042)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-JUN-2016) Wyss Institute, Harvard University, 3 Blackfan Circle,
Wyss Institute Rm517-1D, Boston, MA 02115, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6042
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 12..467
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 493..597
/label=AmpR promoter
CDS 598..1455
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 1629..2217
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(2403..2545)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(2650..2838)
/codon_start=1
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
DELYRSCLARFGDDGENL"
protein_bind complement(3613..3634)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter complement(4729..4806)
/label=lacI promoter
promoter 5115..5133
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind 5134..5158
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 5173..5195
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 5265..5285
/codon_start=1
/label=TEV site
/note="tobacco etch virus (TEV) protease recognition and
cleavage site"
/translation="ENLYFQG"
CDS 5295..5318
/codon_start=1
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
/translation="DYKDDDDK"
terminator 5970..6017
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
This page is informational only.