Basic Vector Information
- Vector Name:
- pENTR223-RGR
- Antibiotic Resistance:
- Streptomycin
- Length:
- 3675 bp
- Type:
- Human ORFeome Gateway entry vector
- Replication origin:
- ori
- Source/Author:
- Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S, Do
- Promoter:
- T7
pENTR223-RGR vector Map
pENTR223-RGR vector Sequence
LOCUS 40924_17528 3675 bp DNA circular SYN 15-JAN-2024
DEFINITION Human ORFeome Gateway entry vector pENTR223-RGR, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3675)
AUTHORS Rual JF, Hirozane-Kishikawa T, Hao T, Bertin N, Li S, Dricot A, Li
N, Rosenberg J, Lamesch P, Vidalain PO, Clingingsmith TR, Hartley
JL, Esposito D, Cheo D, Moore T, Simmons B, Sequerra R, Bosak S,
Doucette-Stamm L, Le Peuch C, Vandenhaute J, Cusick ME, Albala JS,
Hill DE, Vidal M.
TITLE Human ORFeome version 1.1: a platform for reverse proteomics
JOURNAL Genome Res. 14 (10B), 2128-2135 (2004)
PUBMED 15489335
REFERENCE 2 (bases 1 to 3675)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 3675)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (06-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 4 (bases 1 to 3675)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(06-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(06-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
FEATURES Location/Qualifiers
source 1..3675
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(88..115)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(207..293)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 357..373
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 389..486
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
CDS 488..1374
/codon_start=1
/product="RPE-retinal G protein-coupled receptor isoform 1
[Homo sapiens]"
/label=RGR
/note="unnamed protein product; hRGR;incomplete termination
codon for C-terminal fusion"
/protein_id="SJX33318.1"
/translation="MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTP
ELRTPCHLLVLSLALADSGISLNALVAATSSLLRVSHRRWPYGSDGCQAHGFQGFVTAL
ASICSSAAIAWGRYHHYCTRSQLAWNSAVSLVLFVWLSSAFWAALPLLGWGHYDYEPLG
TCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITITSYSLMEQKLGKSGHLQVNTTLPAR
TLLLGWGPYAILYLYAVIADVTSISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIW
QCLSPQKREKDRTK"
protein_bind complement(1375..1473)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
promoter complement(1491..1509)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(1514..1530)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 1961..2749
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin 2845..3433
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.