pBAD/His A vector (Cat. No.: V011896)
Note: The pBAD/His A plasmid vector is an E. coli expression vector designed for the tightly regulated, dose-dependent expression of recombinant proteins. It utilizes the arabinose-inducible araBAD promoter (pBAD), which allows precise control of gene expression by varying the concentration of L-arabinose. The vector adds an N-terminal polyhistidine (6xHis) tag and an Xpress epitope to the expressed protein, facilitating purification and detection. It carries an ampicillin resistance gene for selection and is supplied in different versions (A, B, C) to accommodate cloning of genes in various reading frames.
- Name:
- pBAD/His A
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4102 bp
- Type:
- E. coli Expression Vectors
- Replication origin:
- ori
- Copy Number:
- High copy number
- Promoter:
- araBAD
- Cloning Method:
- Enzyme digestion and ligation
- 5' Primer:
- pBAD-F: ATGCCATAGCATTTTTATCC
- 3' Primer:
- pBAD-R: gatttaatctgtatcagg
- Fusion Tag:
- N-His, N-EK
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Charoenwongwatthana P, Ahmed H, Charlton A, Gidley MD, Telezhkin V, Coulter J, Chang CY. Identification and functional validation of kynureninases from oral bacteria. J Oral Microbiol. 2025 Sep 21;17(1):2561213. doi: 10.1080/20002297.2025.2561213. PMID: 40988889; PMCID: PMC12451956.
pBAD/His A vector (Cat. No.: V011896) Sequence
LOCUS 40924_5754 4102 bp DNA circular SYN 13-JAN-2022
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4102)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 4102)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4102
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 1..285
/label=araBAD promoter
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction (Guzman et al., 1995)"
CDS 331..348
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
CDS 352..384
/codon_start=1
/label=T7 tag (gene 10 leader)
/note="leader peptide from bacteriophage T7 gene 10"
/translation="MASMTGGQQMG"
CDS 388..411
/codon_start=1
/label=Xpress(TM) tag
/note="Xpress(TM) epitope tag, including an enterokinase
recognition and cleavage site"
/translation="DLYDDDDK"
terminator 673..759
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 851..878
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 897..988
/label=AmpR promoter
CDS 989..1846
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 2020..2608
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(2794..2934)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(3201..4076)
/codon_start=1
/label=araC
/note="L-arabinose regulatory protein"
/translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
EKVNDVAVKLS"