Basic Vector Information
- Vector Name:
- pGSC08
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4084 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Talwar D, Gupta PS, Sidharth R, Radha KA, Radhakrishnan S.
- Promoter:
- araBAD
pGSC08 vector Map
pGSC08 vector Sequence
LOCUS 40924_22754 4084 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pGSC08, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4084)
AUTHORS Talwar D, Gupta PS, Sidharth R, Radha KA, Radhakrishnan S.
TITLE Novel gene cloning vectors with specific features
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 4084)
AUTHORS Talwar D, Gupta PS, Sidharth R, Radha KA, Radhakrishnan S.
TITLE Direct Submission
JOURNAL Submitted (26-MAR-2008) R
REFERENCE 3 (bases 1 to 4084)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4084)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(26-MAR-2008) R"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4084
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(460..1176)
/codon_start=1
/label=Cycle 3 GFP
/note="Cycle 3 GFP (Crameri et al., 1996)"
/translation="MASKGEELVPGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
ANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITHGMDELYK"
RBS complement(1184..1206)
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
promoter complement(1233..1398)
/label=araBAD promoter
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction (Guzman et al., 1995)"
primer_bind complement(1451..1467)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1475..1491)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1499..1529)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1544..1565)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1853..2441)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
rep_origin complement(2607..3062)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
CDS complement(3090..3881)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM
TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED
EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT
PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA
FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"
promoter complement(3889..3989)
/label=AmpR promoter
This page is informational only.