Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V005882 | pGRG36pir | In stock, 1 week for quality controls |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pGRG36pir is similar to pGRG36, except that it contains a pir/Pi protein replicates vectors with an R6K origin.
Cells with those thermosensitive plasmids (pGRG36/pGRG36pir) should grown at 30 °C. Bacterial cultures were grown for no more than 18 h.
- Vector Name:
- pGRG36pir
- Antibiotic Resistance:
- Ampicillin
- Length:
- 13905 bp
- Type:
- Cloning vector, Tn7 delivery vector, Bacterial Exp
- Replication origin:
- pSC101 ori
- Source/Author:
- Kvitko BH, Bruckbauer S, Prucha J, McMillan I, Breland EJ, Lehman S, Mladinich K, Choi KH, Karkhoff-Schweizer R, Schweizer HP.
- Copy Number:
- Low Copy
- Promoter:
- araBAD
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 30℃
pGRG36pir vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
Note: DH5alpha in LB + ampicillin, grow at less than 32 degrees C
References
- Kvitko BH, Bruckbauer S, Prucha J, McMillan I, Breland EJ, Lehman S, Mladinich K, Choi KH, Karkhoff-Schweizer R, Schweizer HP. A simple method for construction of pir+ Enterobacterial hosts for maintenance of R6K replicon plasmids. BMC Res Notes. 2012 Mar 20;5:157.
- Stoudenmire JL, Essock-Burns T, Weathers EN, Solaimanpour S, Mrázek J, Stabb EV. An Iterative, Synthetic Approach To Engineer a High-Performance PhoB-Specific Reporter. Appl Environ Microbiol. 2018 Jul 2;84(14):e00603-18.
pGRG36pir vector Sequence
LOCUS V005882 13905 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V005882
VERSION V005882
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 13905)
AUTHORS Kvitko BH, Bruckbauer S, Prucha J, McMillan I, Breland EJ, Lehman S,
Mladinich K, Choi KH, Karkhoff-Schweizer R, Schweizer HP.
TITLE A simple method for construction of pir+ Enterobacterial hosts for
maintenance of R6K replicon plasmids
JOURNAL BMC Res Notes 5, 157 (2012)
PUBMED 22433797
REFERENCE 2 (bases 1 to 13905)
AUTHORS Bruckbauer ST.
TITLE Direct Submission
JOURNAL Submitted (25-JUN-2012) Microbiology Immunology and Pathology,
Colorado State University, IDRC at Foothills Campus, Campus Delivery
0922, Fort Collins, CO 80523-0922, USA
REFERENCE 3 (bases 1 to 13905)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 13905)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Res
Notes 5, 157 (2012)"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(25-JUN-2012) Microbiology Immunology and Pathology, Colorado State
University, IDRC at Foothills Campus, Campus Delivery 0922, Fort
Collins, CO 80523-0922, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..13905
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(149..1024)
/label="araC"
/note="L-arabinose regulatory protein"
promoter 1051..1335
/label="araBAD promoter"
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction (Guzman et al., 1995)"
CDS 1453..2271
/gene="tnsA"
/label="Transposon Tn7 transposition protein TnsA"
/note="Transposon Tn7 transposition protein TnsA from
Escherichia coli. Accession#: P13988"
CDS 2261..4366
/gene="tnsB"
/label="Transposon Tn7 transposition protein TnsB"
/note="Transposon Tn7 transposition protein TnsB from
Escherichia coli. Accession#: P13989"
CDS 4366..6030
/gene="tnsC"
/label="Transposon Tn7 transposition protein TnsC"
/note="Transposon Tn7 transposition protein TnsC from
Escherichia coli. Accession#: P05846"
CDS 6036..7562
/codon_start=1
/gene="tnsD"
/product="TnsD"
/label="tnsD"
/note="Tn7 transposase D"
/protein_id="AFR24693.1"
/translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT
LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV
HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR
AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY
QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA
FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ
LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA
VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY
QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE"
gene 6036..7562
/gene="tnsD"
/label="tnsD"
terminator 8196..8282
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 8374..8401
/label="rrnB T2 terminator"
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 8420..8511
/label="AmpR promoter"
CDS 8512..9369
/label="AmpR"
/note="beta-lactamase"
oriT complement(9543..9652)
/direction=LEFT
/label="oriT"
/note="incP origin of transfer"
rep_origin 10392..10614
/label="pSC101 ori"
/note="low-copy replication origin that requires the Rep101
protein"
CDS 10662..11609
/label="Rep101(Ts)"
/note="temperature-sensitive version of the RepA protein
needed for replication with the pSC101 origin (Armstrong et
al., 1984)"
mobile_element 12045..12210
/label="Tn7L"
/note="mini-Tn7 element (left end of the Tn7 transposon)"
protein_bind 12313..12337
/label="attB1"
/note="recombination site for the Gateway(R) BP reaction"
CDS 12472..13386
/gene="pir"
/label="PI protein"
/note="PI protein from Escherichia coli. Accession#:
P03067"
protein_bind complement(13603..13627)
/label="attB2"
/note="recombination site for the Gateway(R) BP reaction"
misc_feature 13694..13905
/label="Tn7R"
/note="Tn7R"