pGPI-SceI-XCm vector (V005912)

LOCUS       V005912                 6601 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005912
VERSION     V005912
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6601)
  AUTHORS   Hamad MA, Skeldon AM, Valvano MA.
  TITLE     Construction of aminoglycoside-sensitive Burkholderia cenocepacia
            strains for use in studies of intracellular bacteria with the
            gentamicin protection assay
  JOURNAL   Appl. Environ. Microbiol. 76 (10), 3170-3176 (2010)
   PUBMED   20348312
REFERENCE   2  (bases 1 to 6601)
  AUTHORS   Hamad MA, Skeldon AM, Valvano MA.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-DEC-2012) Microbiology and Immunology, Western
            University, 1151 Richmond Street North, London, Ontario N6A 5C1,
            Canada
REFERENCE   3  (bases 1 to 6601)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6601)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2010"; volume: "76"; issue: "10";
            pages: "3170-3176"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (21-DEC-2012) Microbiology and Immunology, Western University, 1151
            Richmond Street North, London, Ontario N6A 5C1, Canada"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6601
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     oriT            626..735
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             768..1136
                     /label="traJ"
                     /note="oriT-recognizing protein"
     CDS             complement(1102..1527)
                     /codon_start=1
                     /product="TraI"
                     /label="TraI"
                     /protein_id="AGC79933.1"
                     /translation="MNVQVVGVVMHGTDALMLGEAKPSADAVLNRAQRLRVGLLSRAEA
                     NQQVIGLVGLGTGVAVLGRHHLGHDSGQGVCLAVRDAHVTQALGLALLVGDVLHQLREV
                     ALLDGAHGDVLGNHAHPPAVLAAKKVMALPSGGPRPS"
     rep_origin      1757..2145
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     misc_feature    2150..2178
                     /label="multiple cloning site 1"
                     /note="multiple cloning site 1"
     promoter        2194..2222
                     /label="tac promoter"
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     CDS             2254..3174
                     /gene="xylE"
                     /label="Metapyrocatechase"
                     /note="Metapyrocatechase from Pseudomonas putida.
                     Accession#: P06622"
     misc_feature    3183..3216
                     /label="multiple cloning site 2"
                     /note="multiple cloning site 2"
     promoter        3945..3973
                     /label="Pc promoter"
                     /note="class 1 integron promoter"
     CDS             4299..4532
                     /label="TpR"
                     /note="E. coli plasmid-associated dihydrofolate reductase"
     misc_feature    4538..4555
                     /label="I-SceI recognition site"
                     /note="I-SceI recognition site"
     promoter        4927..5029
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             5030..5668
                     /codon_start=1
                     /product="chloramphenicol acetyltransferase"
                     /function="chloramphenicol resistance"
                     /label="chloramphenicol acetyltransferase"
                     /protein_id="AGC79930.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRCLMNTTVLR"