Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V005925 | pAdEasy-2 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Adenoviral vector for use in AdEasy System, for use with large inserts.
- Vector Name:
- pAdEasy-2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 30808 bp
- Type:
- Adenoviral vectors
- Replication origin:
- ori
- Copy Number:
- Low copy number
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
pAdEasy-2 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- He TC, Zhou S, da Costa LT, Yu J, Kinzler KW, Vogelstein B. A simplified system for generating recombinant adenoviruses. Proc Natl Acad Sci U S A. 1998 Mar 3;95(5):2509-14.
pAdEasy-2 vector Sequence
LOCUS V005925 30808 bp DNA circular UNA 27-FEB-2024
DEFINITION Exported.
ACCESSION V005925
VERSION V005925
KEYWORDS .
SOURCE natural DNA sequence
ORGANISM unspecified
.
REFERENCE 1 (bases 1 to 30808)
AUTHORS .
TITLE Direct Submission
COMMENT Annotated with pLannotate v1.2.0
FEATURES Location/Qualifiers
source 1..30808
/mol_type="genomic DNA"
/organism="unspecified"
CDS 27..651
/codon_start=1
/label="TcR (fragment)"
/note="pLannotate"
/note="/fragment=True"
/note="/identity=99.8"
/note="/match_length=52.5"
/note="/other=CDS"
/translation="STDALESLQPSQLLPVGAGHDYRRRTYDCLLYHATRRTGAGSALG
HFRRGPLSLERDDDRPVACGIRNLARPRSSLRHWSRHQTFRREAGHYRRHGGRRAGLRL
AGVRDARLDGLPHYDSSRFRRHRDARVAGHAVQAGR*RPSGTASRIARGSYQPNFDHWT
ADRHGDLCRLGEHMERVGMDCRRRPIPCLPPRVASRCMEPGHLDL"
CDS complement(893..1288)
/codon_start=1
/label="YPB1_ECOLX"
/note="pLannotate"
/note="/database=swissprot"
/note="/fragment=False"
/note="/identity=100.0"
/note="/match_length=100.0"
/note="/other=CDS"
/translation="MPPCKGEFLFMGVMIPMKRERMLTIRVTDDEHARLLERCEGKQLA
VWMRRDQRKITQGQCQRFVNTDVGVPQGSQQHPAMQIRNIMVQGADFRVSRLYETRKPK
TIHVVAQVADVLQQQSLHVRSRIGDSFC"
CDS 1292..1480
/label="rop"
/note="Rop protein, which maintains plasmids at low copy
number"
misc_feature 1585..1725
/label="bom"
/note="basis of mobility region from pBR322"
rep_origin complement(1911..2499)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2673..3530)
/label="AmpR"
/note="beta-lactamase"
promoter complement(3531..3635)
/label="AmpR promoter"
CDS 3770..4189
/gene="IX"
/label="Hexon-interlacing protein"
/note="Hexon-interlacing protein from Human adenovirus C
serotype 5. Accession#: P03281"
CDS complement(4255..5589)
/gene="IVa2"
/label="Packaging protein 1"
/note="Packaging protein 1 from Human adenovirus C serotype
5. Accession#: P03271"
CDS complement(5361..8942)
/gene="POL"
/label="DNA polymerase"
/note="DNA polymerase from Human adenovirus C serotype 2.
Accession#: P03261"
CDS complement(8747..10750)
/gene="PTP"
/label="Preterminal protein"
/note="Preterminal protein from Human adenovirus C serotype
5. Accession#: P04499"
ncRNA 10779..10935
/label="VA"
/note="pLannotate"
/note="/database=Rfam"
/note="/fragment=False"
/note="/identity=100.0"
/note="/match_length=98.7"
/note="/other=ncRNA"
ncRNA 11034..11191
/label="VA"
/note="pLannotate"
/note="/database=Rfam"
/note="/fragment=False"
/note="/identity=100.0"
/note="/match_length=99.4"
/note="/other=ncRNA"
CDS 11209..12453
/gene="L1"
/label="Packaging protein 3"
/note="Packaging protein 3 from Human adenovirus C serotype
5. Accession#: P04496"
CDS 12477..14231
/note="Pre-hexon-linking protein IIIa from Human adenovirus
C serotype 5. Accession#: P12537"
/label="Pre-hexon-linking protein IIIa"
CDS 14315..16027
/gene="L2"
/label="Penton protein"
/note="Penton protein from Human adenovirus C serotype 5.
Accession#: P12538"
CDS 16037..16336
/codon_start=1
/label="L2 (fragment)"
/note="pLannotate"
/note="/database=swissprot"
/note="/fragment=True"
/note="/identity=100.0"
/note="/match_length=50.5"
/note="/other=CDS"
/translation="MSILISPSNNTGWGLRFPSKMFGGAKKRSDQHPVRVRGHYRAPWG
AHKRGRTGRTTVDDAIDAVVEEARNYTPTPPPVSTVDAAIQTVVRGARRYAKMKR"
CDS 16702..17805
/gene="L2"
/label="Core-capsid bridging protein"
/note="Core-capsid bridging protein from Human adenovirus C
serotype 5. Accession#: P24938"
CDS 17836..18075
/note="Pre-core protein X from Human adenovirus C serotype
5. Accession#: Q2KS10"
/label="Pre-core protein X"
CDS 18161..18910
/gene="L3"
/label="Pre-protein VI"
/note="Pre-protein VI from Human adenovirus C serotype 5.
Accession#: P24937"
CDS 19000..21855
/gene="L3"
/label="Hexon protein"
/note="Hexon protein from Human adenovirus C serotype 5.
Accession#: P04133"
CDS 21891..22502
/gene="L3"
/label="Protease"
/note="Protease from Human adenovirus C serotype 5.
Accession#: P03253"
CDS complement(22604..24190)
/gene="DBP"
/label="DNA-binding protein"
/note="DNA-binding protein from Human adenovirus C serotype
5. Accession#: P03265"
CDS 24219..26639
/gene="L4"
/label="Shutoff protein"
/note="Shutoff protein from Human adenovirus C serotype 5.
Accession#: P24933"
CDS 26870..27241
/codon_start=1
/label="SF33K_ADE02 (fragment)"
/note="pLannotate"
/note="/database=swissprot"
/note="/fragment=True"
/note="/identity=96.8"
/note="/match_length=54.4"
/note="/other=CDS"
/translation="AHTAPAAAAAAATAAATQKQRRPDSKTLTKPKKSTAAAAAGGGAL
RLAPNEPVSTRELRNRIFPTLYAIFQQSRGQEQELKIKNRSLRSLTRSCLYHKSEDQLR
RTLEDAEALFSKYCALTLKD"
CDS 27332..28012
/gene="L4"
/label="Pre-hexon-linking protein VIII"
/note="Pre-hexon-linking protein VIII from Human adenovirus
C serotype 5. Accession#: P24936"
CDS 28016..28294
/codon_start=1
/label="E312_ADE02 (fragment)"
/note="pLannotate"
/note="/database=swissprot"
/note="/fragment=True"
/note="/identity=86.0"
/note="/match_length=86.9"
/note="/other=CDS"
/translation="MLSGEAEQLRLKHLVHCRRHKCFARDSGEFCYFELPEDHIEGPAH
GVRLTAQGELARSLIREFTQRPLLVERDRGPCVLTVICNCPNLGLHQD"
CDS 28545..30287
/note="Fiber protein from Human adenovirus C serotype 5.
Accession#: P11818"
/label="Fiber protein"
repeat_region 30704..30806
/label="ITR"
/note="inverted terminal repeat of human adenovirus
serotype 5"