pGGZ001 vector (V005982)

LOCUS       40924_21863        4114 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pGGZ001, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4114)
  AUTHORS   Lampropoulos A, Sutikovic Z, Wenzl C, Maegele I, Lohmann JU, Forner 
            J.
  TITLE     GreenGate - A Novel, Versatile, and Efficient Cloning System for 
            Plant Transgenesis
  JOURNAL   PLoS ONE 8 (12), E83043 (2013)
  PUBMED    24376629
REFERENCE   2  (bases 1 to 4114)
  AUTHORS   Forner J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-SEP-2013) Centre for Organismal Studies, 
            Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230, 
            Heidelberg D-69221, Germany
REFERENCE   3  (bases 1 to 4114)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4114)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; 
            date: "2013"; volume: "8"; issue: "12"; pages: "E83043"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-SEP-2013) Centre for Organismal Studies, 
            Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230, 
            Heidelberg D-69221, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4114
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      26..515
                     /note="for replication in Agrobacterium tumefaciens; pSa
                     origin of replication"
     misc_feature    534..556
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA
                     (truncated)"
     misc_feature    complement(645..650)
                     /label=BsaI recognition site
                     /note="BsaI recognition site"
     CDS             781..1437
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             1459..1761
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     CDS             1783..2034
                     /codon_start=1
                     /gene="lacZ alpha"
                     /product="beta-galactosidase alpha peptide"
                     /label=lacZ alpha
                     /protein_id="AHE38485.1"
                     /translation="MLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ
                     LRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICSDAA"
     gene            1783..2034
                     /gene="lacZ alpha"
                     /label=lacZ alpha
     misc_feature    2078..2083
                     /label=BsaI recognition site
                     /note="BsaI recognition site"
     misc_feature    2133..2157
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      complement(2248..2836)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3007..3795)
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenyltransferase A"
                     /label=aadA
                     /protein_id="AHE38482.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            complement(3007..3795)
                     /gene="aadA"
                     /label=aadA
     rep_origin      4086..4114
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"